Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NJY3

Protein Details
Accession J3NJY3   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
143-166RGVMRIPRTHARRGKRPPRDRPRPBasic
NLS Segment(s)
PositionSequence
147-166RIPRTHARRGKRPPRDRPRP
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
Amino Acid Sequences MAAQRQMGGERPKWRRGDRLPEVPVRGVPEWLRPGSRWMGAEEGRGRLHTSGLERIGAQDQGAEHNIDGVWYSWSQRTQPLPFLLGPLDRQGSLGSLPWTPALFFRRDVTPPTKPDAGVPRAAPNLLQNGSSEPVAEAADGPRGVMRIPRTHARRGKRPPRDRPRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.69
4 0.73
5 0.72
6 0.75
7 0.73
8 0.71
9 0.7
10 0.61
11 0.54
12 0.48
13 0.4
14 0.34
15 0.28
16 0.28
17 0.3
18 0.3
19 0.3
20 0.26
21 0.3
22 0.3
23 0.31
24 0.26
25 0.22
26 0.26
27 0.24
28 0.29
29 0.27
30 0.26
31 0.24
32 0.24
33 0.23
34 0.18
35 0.18
36 0.15
37 0.16
38 0.17
39 0.17
40 0.17
41 0.16
42 0.17
43 0.17
44 0.15
45 0.12
46 0.09
47 0.08
48 0.09
49 0.1
50 0.09
51 0.07
52 0.08
53 0.08
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.08
60 0.09
61 0.1
62 0.11
63 0.15
64 0.18
65 0.19
66 0.22
67 0.21
68 0.22
69 0.21
70 0.21
71 0.17
72 0.14
73 0.13
74 0.11
75 0.11
76 0.08
77 0.09
78 0.08
79 0.08
80 0.08
81 0.08
82 0.08
83 0.07
84 0.08
85 0.08
86 0.08
87 0.08
88 0.11
89 0.12
90 0.13
91 0.14
92 0.16
93 0.18
94 0.2
95 0.24
96 0.27
97 0.31
98 0.32
99 0.36
100 0.35
101 0.32
102 0.36
103 0.39
104 0.36
105 0.33
106 0.31
107 0.31
108 0.3
109 0.3
110 0.26
111 0.2
112 0.22
113 0.19
114 0.18
115 0.15
116 0.16
117 0.18
118 0.17
119 0.15
120 0.1
121 0.11
122 0.1
123 0.1
124 0.08
125 0.07
126 0.11
127 0.1
128 0.1
129 0.1
130 0.1
131 0.11
132 0.15
133 0.19
134 0.22
135 0.27
136 0.37
137 0.41
138 0.51
139 0.59
140 0.64
141 0.7
142 0.75
143 0.81
144 0.83
145 0.88
146 0.9