Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J8TLJ3

Protein Details
Accession J8TLJ3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
40-60RNPNNLKYVKPQKKQPFATKTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
Amino Acid Sequences HSNYPNGLLPKAKAWQIGYKLLYIPIRYDKNVKSLYKFPRNPNNLKYVKPQKKQPFATKTLAITISPNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.34
4 0.39
5 0.35
6 0.33
7 0.31
8 0.31
9 0.3
10 0.23
11 0.22
12 0.22
13 0.24
14 0.24
15 0.29
16 0.26
17 0.31
18 0.37
19 0.36
20 0.33
21 0.38
22 0.45
23 0.5
24 0.55
25 0.55
26 0.59
27 0.65
28 0.67
29 0.63
30 0.64
31 0.57
32 0.54
33 0.57
34 0.59
35 0.62
36 0.62
37 0.68
38 0.69
39 0.76
40 0.82
41 0.82
42 0.79
43 0.75
44 0.75
45 0.69
46 0.6
47 0.55
48 0.48
49 0.38