Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1H7Q0

Protein Details
Accession A0A2I1H7Q0    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-45IRIDSGGKRIKKKPPKHCQNCKETNDCVHydrophilic
NLS Segment(s)
PositionSequence
24-33GKRIKKKPPK
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 9.5
Family & Domain DBs
Amino Acid Sequences MKISKTRLFRNVNVYQKIRIDSGGKRIKKKPPKHCQNCKETNDCVKLFLNKTNRLEGIVGNFRKNLPMKTNKISIFRAKFTLNSVPCELEYDLSRFTLENLQKLADFTTQNCNNKKDNIPCELEYDLSRFTLENLQKLADFTTQNYNTTIKIIVLLAKRINIFRIIKFKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.6
3 0.57
4 0.55
5 0.46
6 0.4
7 0.36
8 0.32
9 0.39
10 0.44
11 0.46
12 0.52
13 0.59
14 0.66
15 0.72
16 0.79
17 0.79
18 0.81
19 0.87
20 0.9
21 0.93
22 0.92
23 0.92
24 0.92
25 0.87
26 0.82
27 0.76
28 0.74
29 0.69
30 0.6
31 0.52
32 0.45
33 0.44
34 0.4
35 0.41
36 0.4
37 0.4
38 0.43
39 0.43
40 0.41
41 0.37
42 0.35
43 0.29
44 0.27
45 0.28
46 0.27
47 0.24
48 0.25
49 0.23
50 0.27
51 0.29
52 0.26
53 0.25
54 0.32
55 0.36
56 0.39
57 0.46
58 0.44
59 0.46
60 0.47
61 0.47
62 0.42
63 0.38
64 0.36
65 0.31
66 0.28
67 0.27
68 0.31
69 0.24
70 0.24
71 0.23
72 0.21
73 0.2
74 0.22
75 0.19
76 0.12
77 0.12
78 0.11
79 0.11
80 0.1
81 0.1
82 0.08
83 0.09
84 0.15
85 0.15
86 0.16
87 0.16
88 0.16
89 0.16
90 0.17
91 0.17
92 0.13
93 0.12
94 0.12
95 0.21
96 0.26
97 0.33
98 0.36
99 0.39
100 0.38
101 0.43
102 0.48
103 0.47
104 0.45
105 0.45
106 0.46
107 0.43
108 0.43
109 0.39
110 0.34
111 0.26
112 0.24
113 0.19
114 0.14
115 0.14
116 0.1
117 0.1
118 0.16
119 0.16
120 0.16
121 0.16
122 0.16
123 0.16
124 0.17
125 0.17
126 0.13
127 0.13
128 0.13
129 0.22
130 0.23
131 0.25
132 0.27
133 0.26
134 0.24
135 0.25
136 0.23
137 0.13
138 0.13
139 0.13
140 0.17
141 0.18
142 0.22
143 0.22
144 0.24
145 0.27
146 0.27
147 0.28
148 0.3
149 0.31
150 0.33