Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HW31

Protein Details
Accession A0A2I1HW31    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MTNKNKKDKKSKKSKKRHHSDSDSDRKSDBasic
33-60STKQGDPELRRTKRRRSEPTKKQKPALIHydrophilic
NLS Segment(s)
PositionSequence
4-56KNKKDKKSKKSKKRHHSDSDSDRKSDKQSSTKQGDPELRRTKRRRSEPTKKQK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MTNKNKKDKKSKKSKKRHHSDSDSDRKSDKQSSTKQGDPELRRTKRRRSEPTKKQKPALIDIVQDKGNSGCEIMKGKKPIFIDLVDEDDEGNDDTIQQNERNNDQSTQQNERNNDSNESALQMQVEELTRLLKSVTKGKQKVTDPKENIIDWSNVDLETQGPKSQKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.96
2 0.95
3 0.96
4 0.95
5 0.95
6 0.93
7 0.92
8 0.91
9 0.91
10 0.84
11 0.75
12 0.67
13 0.59
14 0.55
15 0.52
16 0.48
17 0.46
18 0.51
19 0.58
20 0.62
21 0.64
22 0.61
23 0.6
24 0.62
25 0.57
26 0.59
27 0.6
28 0.61
29 0.66
30 0.7
31 0.74
32 0.75
33 0.81
34 0.81
35 0.82
36 0.86
37 0.87
38 0.92
39 0.93
40 0.89
41 0.83
42 0.75
43 0.69
44 0.63
45 0.6
46 0.5
47 0.43
48 0.38
49 0.36
50 0.33
51 0.29
52 0.23
53 0.16
54 0.14
55 0.11
56 0.09
57 0.07
58 0.08
59 0.12
60 0.14
61 0.18
62 0.21
63 0.22
64 0.25
65 0.25
66 0.25
67 0.24
68 0.21
69 0.2
70 0.16
71 0.18
72 0.15
73 0.14
74 0.12
75 0.09
76 0.09
77 0.07
78 0.06
79 0.04
80 0.04
81 0.04
82 0.06
83 0.07
84 0.08
85 0.11
86 0.13
87 0.15
88 0.19
89 0.2
90 0.2
91 0.22
92 0.27
93 0.29
94 0.34
95 0.37
96 0.38
97 0.39
98 0.42
99 0.45
100 0.42
101 0.39
102 0.34
103 0.3
104 0.25
105 0.25
106 0.21
107 0.15
108 0.12
109 0.09
110 0.08
111 0.08
112 0.09
113 0.07
114 0.07
115 0.08
116 0.08
117 0.08
118 0.08
119 0.1
120 0.13
121 0.21
122 0.29
123 0.39
124 0.43
125 0.48
126 0.56
127 0.61
128 0.69
129 0.68
130 0.7
131 0.64
132 0.67
133 0.66
134 0.58
135 0.53
136 0.46
137 0.39
138 0.3
139 0.28
140 0.23
141 0.18
142 0.17
143 0.15
144 0.13
145 0.17
146 0.18
147 0.19