Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H4U4

Protein Details
Accession A0A2I1H4U4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRGRDRDRLKGKTNTRRNISBasic
NLS Segment(s)
PositionSequence
11-13KGK
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MGRGRDRDRLKGKTNTRRNISAKNKIKTRQINFDKDVESDSNNDNIQKHHNKRTKVDHEGIVYDINSLGFIFSYDLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.8
3 0.78
4 0.79
5 0.76
6 0.77
7 0.75
8 0.75
9 0.75
10 0.73
11 0.74
12 0.7
13 0.74
14 0.73
15 0.69
16 0.69
17 0.67
18 0.66
19 0.62
20 0.59
21 0.51
22 0.42
23 0.39
24 0.29
25 0.22
26 0.17
27 0.15
28 0.14
29 0.14
30 0.15
31 0.13
32 0.14
33 0.21
34 0.29
35 0.34
36 0.43
37 0.49
38 0.52
39 0.59
40 0.68
41 0.68
42 0.66
43 0.65
44 0.59
45 0.55
46 0.51
47 0.46
48 0.37
49 0.28
50 0.2
51 0.16
52 0.11
53 0.09
54 0.08
55 0.07
56 0.05
57 0.06