Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HM60

Protein Details
Accession A0A2I1HM60    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
48-70NRGGKNKKSGKGGKSKKKSKKGWBasic
NLS Segment(s)
PositionSequence
44-70KKQVNRGGKNKKSGKGGKSKKKSKKGW
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences NIVADEKVGQKRGNKDELSRGMVNSDGTEDDSESETSESKIEDKKQVNRGGKNKKSGKGGKSKKKSKKGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.53
4 0.55
5 0.55
6 0.47
7 0.4
8 0.33
9 0.31
10 0.28
11 0.19
12 0.15
13 0.09
14 0.09
15 0.09
16 0.08
17 0.08
18 0.09
19 0.09
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.07
26 0.08
27 0.12
28 0.14
29 0.22
30 0.27
31 0.34
32 0.42
33 0.5
34 0.55
35 0.6
36 0.68
37 0.71
38 0.72
39 0.75
40 0.75
41 0.72
42 0.75
43 0.74
44 0.73
45 0.73
46 0.77
47 0.78
48 0.81
49 0.87
50 0.87