Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1DWX5

Protein Details
Accession A0A2I1DWX5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
24-43KYKTCCRSKLWNLRDKRNSEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 14, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003618  TFIIS_cen_dom  
IPR036575  TFIIS_cen_dom_sf  
Gene Ontology GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF07500  TFIIS_M  
PROSITE View protein in PROSITE  
PS51321  TFIIS_CENTRAL  
Amino Acid Sequences MAELAKKIEESIFTNTGSSPYDVKYKTCCRSKLWNLRDKRNSEFVNKVISGTIKAEDVYKLTGDEMLSHEKYYQKQSEIRRMVENCVRYESDLVPMKLESDGSLSSCMSGGSGGTVWVSRNMLDKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.22
4 0.21
5 0.2
6 0.15
7 0.14
8 0.21
9 0.22
10 0.24
11 0.3
12 0.37
13 0.44
14 0.5
15 0.52
16 0.5
17 0.6
18 0.68
19 0.71
20 0.72
21 0.72
22 0.71
23 0.78
24 0.81
25 0.75
26 0.69
27 0.66
28 0.59
29 0.56
30 0.53
31 0.44
32 0.41
33 0.37
34 0.32
35 0.24
36 0.22
37 0.18
38 0.15
39 0.14
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.08
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.07
52 0.08
53 0.12
54 0.12
55 0.12
56 0.14
57 0.15
58 0.18
59 0.23
60 0.23
61 0.22
62 0.28
63 0.33
64 0.43
65 0.45
66 0.45
67 0.46
68 0.44
69 0.46
70 0.46
71 0.43
72 0.34
73 0.33
74 0.31
75 0.25
76 0.26
77 0.22
78 0.24
79 0.27
80 0.25
81 0.23
82 0.22
83 0.22
84 0.2
85 0.2
86 0.13
87 0.09
88 0.1
89 0.1
90 0.11
91 0.11
92 0.1
93 0.1
94 0.1
95 0.07
96 0.07
97 0.06
98 0.06
99 0.06
100 0.06
101 0.06
102 0.07
103 0.08
104 0.11
105 0.12
106 0.12