Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1H8I7

Protein Details
Accession A0A2I1H8I7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-91QHSIPNFKKAQPKPKAKNTPNMKRSGSHydrophilic
NLS Segment(s)
PositionSequence
73-83KAQPKPKAKNT
Subcellular Location(s) mito 23.5, mito_nucl 13.333, cyto_nucl 2.333
Family & Domain DBs
Amino Acid Sequences MATLWTDRKPCNFLMTCGASSFKIIQTSKGRRKLVAYFENWETTLKALDTPQFFIPDGKELKWCQHSIPNFKKAQPKPKAKNTPNMKRSGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.4
3 0.36
4 0.33
5 0.33
6 0.24
7 0.24
8 0.23
9 0.17
10 0.2
11 0.19
12 0.25
13 0.33
14 0.43
15 0.51
16 0.58
17 0.58
18 0.52
19 0.56
20 0.55
21 0.54
22 0.5
23 0.43
24 0.38
25 0.38
26 0.38
27 0.35
28 0.29
29 0.21
30 0.15
31 0.13
32 0.09
33 0.08
34 0.07
35 0.1
36 0.11
37 0.13
38 0.13
39 0.14
40 0.14
41 0.15
42 0.15
43 0.16
44 0.17
45 0.16
46 0.19
47 0.19
48 0.24
49 0.28
50 0.28
51 0.26
52 0.31
53 0.37
54 0.44
55 0.51
56 0.54
57 0.52
58 0.57
59 0.65
60 0.65
61 0.69
62 0.69
63 0.72
64 0.74
65 0.82
66 0.88
67 0.84
68 0.86
69 0.86
70 0.87
71 0.84