Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GQN5

Protein Details
Accession A0A2I1GQN5    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
14-42AREIQAQKLKEKKNDKRRTERLTNKEQFSHydrophilic
NLS Segment(s)
PositionSequence
21-31KLKEKKNDKRR
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MPRISKQVCHLKRAREIQAQKLKEKKNDKRRTERLTNKEQFSLISSIQKLSEEELPAANHLIRTMHYPKGPNKGKLISPYFQNKAQEYVLQNLYKNKTSITSLQETNNKMVSKIKQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.67
3 0.68
4 0.7
5 0.73
6 0.7
7 0.68
8 0.69
9 0.68
10 0.67
11 0.73
12 0.73
13 0.75
14 0.81
15 0.83
16 0.85
17 0.88
18 0.88
19 0.88
20 0.88
21 0.85
22 0.85
23 0.82
24 0.74
25 0.65
26 0.56
27 0.46
28 0.39
29 0.33
30 0.23
31 0.2
32 0.18
33 0.17
34 0.17
35 0.17
36 0.14
37 0.13
38 0.14
39 0.11
40 0.11
41 0.12
42 0.12
43 0.11
44 0.12
45 0.1
46 0.07
47 0.07
48 0.06
49 0.06
50 0.11
51 0.13
52 0.16
53 0.18
54 0.23
55 0.27
56 0.37
57 0.42
58 0.41
59 0.42
60 0.42
61 0.43
62 0.46
63 0.47
64 0.38
65 0.38
66 0.42
67 0.41
68 0.41
69 0.42
70 0.36
71 0.34
72 0.33
73 0.33
74 0.28
75 0.3
76 0.31
77 0.29
78 0.3
79 0.34
80 0.36
81 0.35
82 0.33
83 0.29
84 0.26
85 0.28
86 0.32
87 0.31
88 0.33
89 0.33
90 0.39
91 0.44
92 0.45
93 0.44
94 0.44
95 0.39
96 0.34
97 0.38