Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HN58

Protein Details
Accession A0A2I1HN58    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-41MIRNFKTVYRNGKRNKNKKRIEDKRAANSLHHydrophilic
NLS Segment(s)
PositionSequence
22-34GKRNKNKKRIEDK
Subcellular Location(s) nucl 15, mito 5, cyto 3.5, cyto_pero 3.5, pero 2.5
Family & Domain DBs
Amino Acid Sequences MQKNDLEKVWMIRNFKTVYRNGKRNKNKKRIEDKRAANSLHSKVNDTLIPQTPPERIYMGLSNMATRNKQNLLPTERIIAEMNQGLGINLIGKWQLQKKENVDSDNDGDDDDDIGIGNLEELASKPLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.43
4 0.42
5 0.48
6 0.54
7 0.62
8 0.64
9 0.72
10 0.79
11 0.84
12 0.88
13 0.88
14 0.87
15 0.89
16 0.92
17 0.91
18 0.9
19 0.89
20 0.86
21 0.84
22 0.81
23 0.71
24 0.63
25 0.59
26 0.53
27 0.49
28 0.41
29 0.35
30 0.29
31 0.3
32 0.27
33 0.22
34 0.23
35 0.2
36 0.2
37 0.18
38 0.19
39 0.18
40 0.17
41 0.17
42 0.14
43 0.12
44 0.13
45 0.14
46 0.13
47 0.14
48 0.13
49 0.13
50 0.14
51 0.14
52 0.13
53 0.13
54 0.15
55 0.14
56 0.16
57 0.18
58 0.23
59 0.27
60 0.29
61 0.29
62 0.28
63 0.27
64 0.26
65 0.24
66 0.18
67 0.14
68 0.12
69 0.11
70 0.09
71 0.09
72 0.07
73 0.07
74 0.06
75 0.05
76 0.04
77 0.05
78 0.05
79 0.05
80 0.1
81 0.15
82 0.21
83 0.24
84 0.31
85 0.35
86 0.44
87 0.48
88 0.47
89 0.45
90 0.43
91 0.42
92 0.37
93 0.33
94 0.23
95 0.19
96 0.17
97 0.14
98 0.1
99 0.07
100 0.05
101 0.05
102 0.05
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05