Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HWQ0

Protein Details
Accession A0A2I1HWQ0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
98-135IKKHLQHRRDYVKRKNNIQHKKGKEKEKEREREREKEKBasic
NLS Segment(s)
PositionSequence
100-150KHLQHRRDYVKRKNNIQHKKGKEKEKEREREREKEKEKERENEKEKEKEKE
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences SSTPASIPFPTAVAKIIYKPTKRYIKVEEILALTDLKKNEYNNLLSEVRFVMASLHTDFNIPYKSQNINLISKIIKKFTKRNPNAPFGEGNWVVKELIKKHLQHRRDYVKRKNNIQHKKGKEKEKEREREREKEKEKERENEKEKEKEKENRNEIERENENIKCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.27
4 0.33
5 0.36
6 0.4
7 0.48
8 0.56
9 0.58
10 0.61
11 0.6
12 0.62
13 0.61
14 0.58
15 0.52
16 0.43
17 0.4
18 0.34
19 0.27
20 0.18
21 0.18
22 0.16
23 0.15
24 0.17
25 0.17
26 0.21
27 0.25
28 0.26
29 0.24
30 0.29
31 0.27
32 0.24
33 0.25
34 0.21
35 0.17
36 0.14
37 0.13
38 0.08
39 0.08
40 0.1
41 0.11
42 0.11
43 0.11
44 0.11
45 0.11
46 0.13
47 0.14
48 0.12
49 0.11
50 0.14
51 0.16
52 0.17
53 0.23
54 0.23
55 0.24
56 0.24
57 0.25
58 0.23
59 0.26
60 0.26
61 0.24
62 0.24
63 0.26
64 0.34
65 0.41
66 0.52
67 0.51
68 0.6
69 0.62
70 0.65
71 0.63
72 0.57
73 0.48
74 0.38
75 0.39
76 0.29
77 0.24
78 0.17
79 0.16
80 0.14
81 0.14
82 0.16
83 0.12
84 0.18
85 0.22
86 0.25
87 0.33
88 0.42
89 0.45
90 0.48
91 0.56
92 0.61
93 0.65
94 0.72
95 0.74
96 0.75
97 0.78
98 0.81
99 0.81
100 0.81
101 0.81
102 0.81
103 0.8
104 0.79
105 0.84
106 0.82
107 0.84
108 0.83
109 0.83
110 0.85
111 0.85
112 0.87
113 0.83
114 0.86
115 0.83
116 0.82
117 0.8
118 0.8
119 0.76
120 0.76
121 0.78
122 0.77
123 0.78
124 0.77
125 0.78
126 0.78
127 0.77
128 0.76
129 0.74
130 0.74
131 0.72
132 0.7
133 0.71
134 0.7
135 0.74
136 0.75
137 0.75
138 0.74
139 0.74
140 0.73
141 0.67
142 0.66
143 0.59
144 0.54
145 0.52