Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GR32

Protein Details
Accession A0A2I1GR32    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
197-219VIANTKAKKVQQRKLDNKDQDELHydrophilic
NLS Segment(s)
PositionSequence
61-65RRKGK
Subcellular Location(s) cyto_mito 8.333, cyto 8, mito 7.5, cyto_nucl 6.833, nucl 4.5, plas 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007248  Mpv17_PMP22  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04117  Mpv17_PMP22  
Amino Acid Sequences MTAQSKPVPIKEKSQSFPSYLLALYLQQLHTNPLRTKAITSGMLSGLQEFVAQELSGTSRRRKGKAKENDQSNLIDEKILKMALYGFLVSGPLNHLLFEMLNKLFKNRTGDSSKLMQILTSQLIITPIQNTVYLIAMAVIGGINDPAQIRKTVRKSLWPIMKMSWIVSPMAMGFAQRFLPPQLWVPFFNLVGFVFGVIANTKAKKVQQRKLDNKDQDELDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.57
3 0.53
4 0.52
5 0.45
6 0.38
7 0.29
8 0.26
9 0.19
10 0.16
11 0.15
12 0.16
13 0.14
14 0.15
15 0.15
16 0.18
17 0.21
18 0.27
19 0.27
20 0.3
21 0.33
22 0.32
23 0.33
24 0.32
25 0.33
26 0.29
27 0.28
28 0.25
29 0.22
30 0.22
31 0.2
32 0.17
33 0.13
34 0.1
35 0.09
36 0.07
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.08
43 0.12
44 0.16
45 0.2
46 0.27
47 0.33
48 0.38
49 0.47
50 0.54
51 0.59
52 0.67
53 0.74
54 0.74
55 0.76
56 0.73
57 0.66
58 0.59
59 0.5
60 0.41
61 0.3
62 0.23
63 0.16
64 0.14
65 0.13
66 0.11
67 0.09
68 0.07
69 0.08
70 0.07
71 0.08
72 0.07
73 0.05
74 0.05
75 0.06
76 0.06
77 0.05
78 0.06
79 0.07
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.07
86 0.09
87 0.07
88 0.09
89 0.09
90 0.11
91 0.11
92 0.14
93 0.19
94 0.18
95 0.23
96 0.26
97 0.27
98 0.29
99 0.31
100 0.3
101 0.26
102 0.24
103 0.18
104 0.14
105 0.15
106 0.12
107 0.09
108 0.08
109 0.06
110 0.08
111 0.08
112 0.08
113 0.07
114 0.06
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.06
121 0.05
122 0.05
123 0.04
124 0.04
125 0.04
126 0.03
127 0.02
128 0.02
129 0.03
130 0.02
131 0.03
132 0.04
133 0.05
134 0.06
135 0.08
136 0.11
137 0.19
138 0.25
139 0.32
140 0.34
141 0.42
142 0.47
143 0.54
144 0.6
145 0.54
146 0.51
147 0.45
148 0.47
149 0.39
150 0.34
151 0.27
152 0.2
153 0.18
154 0.15
155 0.14
156 0.09
157 0.1
158 0.09
159 0.07
160 0.07
161 0.08
162 0.09
163 0.09
164 0.11
165 0.11
166 0.13
167 0.14
168 0.2
169 0.24
170 0.25
171 0.26
172 0.28
173 0.29
174 0.28
175 0.26
176 0.21
177 0.16
178 0.15
179 0.13
180 0.1
181 0.08
182 0.07
183 0.08
184 0.07
185 0.09
186 0.11
187 0.13
188 0.14
189 0.18
190 0.24
191 0.34
192 0.44
193 0.5
194 0.57
195 0.67
196 0.77
197 0.83
198 0.88
199 0.86
200 0.82
201 0.79