Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GNR7

Protein Details
Accession A0A2I1GNR7    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
13-39SAGDFLPAKKKRKKCWQHEPNERSNIQHydrophilic
NLS Segment(s)
PositionSequence
21-25KKKRK
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MHSLVAAESVSGSAGDFLPAKKKRKKCWQHEPNERSNIQQVISELNGIDLINPTDPESNNENITTGGEVFVAKIMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.07
3 0.08
4 0.08
5 0.18
6 0.25
7 0.33
8 0.41
9 0.5
10 0.59
11 0.69
12 0.79
13 0.8
14 0.85
15 0.87
16 0.89
17 0.91
18 0.88
19 0.85
20 0.81
21 0.71
22 0.61
23 0.53
24 0.43
25 0.32
26 0.26
27 0.18
28 0.13
29 0.13
30 0.12
31 0.08
32 0.07
33 0.07
34 0.06
35 0.06
36 0.05
37 0.06
38 0.06
39 0.07
40 0.08
41 0.1
42 0.11
43 0.15
44 0.18
45 0.2
46 0.21
47 0.21
48 0.2
49 0.17
50 0.18
51 0.15
52 0.12
53 0.1
54 0.08
55 0.08
56 0.08