Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GC58

Protein Details
Accession A0A2I1GC58    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
167-189DIIACSHRKKRAQSLQRLEDKLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 13.5, cyto 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006703  G_AIG1  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF04548  AIG1  
Amino Acid Sequences MSEQSIILFGRTGYGKSSIANMLIQGDIYQNNAFKISDNAKGETLNIYTSYTEKYQVFDTVGLGEPPSHLVSHKEAVNKIRDYFSKFKVTLNYIFYVQKKGRITDEDKKMFKLFKEIFEWAEKNIVIIITNSKPEWVEKNLETITEDLGKYPIISVDFPFTDEDEDDIIACSHRKKRAQSLQRLEDKLLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.2
5 0.18
6 0.18
7 0.18
8 0.16
9 0.14
10 0.13
11 0.13
12 0.1
13 0.1
14 0.09
15 0.11
16 0.12
17 0.12
18 0.12
19 0.14
20 0.13
21 0.12
22 0.18
23 0.19
24 0.24
25 0.26
26 0.27
27 0.27
28 0.27
29 0.27
30 0.23
31 0.21
32 0.15
33 0.13
34 0.12
35 0.11
36 0.12
37 0.14
38 0.13
39 0.16
40 0.15
41 0.16
42 0.16
43 0.17
44 0.17
45 0.15
46 0.14
47 0.12
48 0.12
49 0.11
50 0.1
51 0.08
52 0.07
53 0.09
54 0.09
55 0.07
56 0.08
57 0.1
58 0.13
59 0.16
60 0.18
61 0.19
62 0.21
63 0.25
64 0.3
65 0.3
66 0.28
67 0.28
68 0.27
69 0.31
70 0.33
71 0.33
72 0.34
73 0.33
74 0.33
75 0.34
76 0.35
77 0.32
78 0.3
79 0.27
80 0.22
81 0.25
82 0.23
83 0.26
84 0.23
85 0.25
86 0.24
87 0.24
88 0.24
89 0.27
90 0.33
91 0.36
92 0.45
93 0.46
94 0.46
95 0.46
96 0.46
97 0.43
98 0.36
99 0.37
100 0.29
101 0.26
102 0.29
103 0.29
104 0.29
105 0.31
106 0.32
107 0.23
108 0.23
109 0.19
110 0.15
111 0.14
112 0.12
113 0.08
114 0.08
115 0.12
116 0.1
117 0.12
118 0.12
119 0.12
120 0.13
121 0.15
122 0.18
123 0.18
124 0.22
125 0.21
126 0.26
127 0.26
128 0.26
129 0.25
130 0.21
131 0.19
132 0.17
133 0.17
134 0.12
135 0.12
136 0.12
137 0.11
138 0.11
139 0.11
140 0.09
141 0.1
142 0.11
143 0.14
144 0.15
145 0.16
146 0.16
147 0.15
148 0.15
149 0.15
150 0.15
151 0.12
152 0.12
153 0.11
154 0.1
155 0.1
156 0.09
157 0.11
158 0.16
159 0.22
160 0.3
161 0.37
162 0.43
163 0.54
164 0.64
165 0.73
166 0.78
167 0.81
168 0.83
169 0.86
170 0.82