Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G6Y9

Protein Details
Accession A0A2I1G6Y9    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
38-57NPTITKHKRRLPKRLKSSIEHydrophilic
NLS Segment(s)
PositionSequence
44-52HKRRLPKRL
99-102RKKK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MQHELVNLLKAFIYNVYNKNVQETQETQETETFTDINNPTITKHKRRLPKRLKSSIETSEKRVLKDSTNVNITENETRGRKCDTYMSGISDGRSYLKERKKKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.24
4 0.27
5 0.27
6 0.32
7 0.32
8 0.3
9 0.3
10 0.3
11 0.29
12 0.32
13 0.32
14 0.28
15 0.27
16 0.27
17 0.22
18 0.2
19 0.16
20 0.1
21 0.16
22 0.16
23 0.15
24 0.15
25 0.15
26 0.16
27 0.24
28 0.31
29 0.32
30 0.39
31 0.44
32 0.52
33 0.6
34 0.7
35 0.72
36 0.77
37 0.79
38 0.81
39 0.78
40 0.73
41 0.7
42 0.67
43 0.65
44 0.56
45 0.51
46 0.5
47 0.47
48 0.44
49 0.42
50 0.36
51 0.29
52 0.33
53 0.33
54 0.3
55 0.31
56 0.31
57 0.28
58 0.28
59 0.29
60 0.26
61 0.23
62 0.22
63 0.22
64 0.22
65 0.24
66 0.28
67 0.25
68 0.24
69 0.3
70 0.29
71 0.33
72 0.35
73 0.36
74 0.35
75 0.35
76 0.34
77 0.27
78 0.25
79 0.2
80 0.2
81 0.2
82 0.27
83 0.36