Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HUL1

Protein Details
Accession A0A2I1HUL1   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
79-103PQGNPKKPPNPVRRISNPRTCRPYPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12.5, mito_nucl 10.5, nucl 7.5, cyto 3.5, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MSRTMAPELWHPNYGSRTMAPELWHLNYGSRTMTPKYDPLCPELWQLNYGTRTMAAELWHLNYGSRTMAPELWQPNYDPQGNPKKPPNPVRRISNPRTCRPYPGIHSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.31
3 0.24
4 0.25
5 0.25
6 0.26
7 0.22
8 0.24
9 0.25
10 0.25
11 0.25
12 0.21
13 0.21
14 0.2
15 0.2
16 0.17
17 0.16
18 0.17
19 0.17
20 0.2
21 0.19
22 0.24
23 0.25
24 0.29
25 0.29
26 0.29
27 0.29
28 0.28
29 0.28
30 0.26
31 0.24
32 0.19
33 0.19
34 0.19
35 0.18
36 0.17
37 0.14
38 0.11
39 0.11
40 0.1
41 0.1
42 0.07
43 0.07
44 0.08
45 0.09
46 0.09
47 0.09
48 0.09
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.09
56 0.11
57 0.16
58 0.18
59 0.19
60 0.19
61 0.2
62 0.23
63 0.26
64 0.27
65 0.22
66 0.28
67 0.37
68 0.4
69 0.44
70 0.48
71 0.51
72 0.58
73 0.68
74 0.7
75 0.68
76 0.73
77 0.77
78 0.79
79 0.82
80 0.82
81 0.82
82 0.8
83 0.8
84 0.81
85 0.74
86 0.71
87 0.66
88 0.66