Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HJ26

Protein Details
Accession A0A2I1HJ26   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-45HPNFAPTKKQCRTKWNSLKSHydrophilic
94-148NQVDRRRYEYRERRRSRSRSSHHRHERRRSRSRSPRRERRERRERRRNYSLTPVIBasic
NLS Segment(s)
PositionSequence
90-140AARRNQVDRRRYEYRERRRSRSRSSHHRHERRRSRSRSPRRERRERRERRR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR044822  Myb_DNA-bind_4  
Pfam View protein in Pfam  
PF13837  Myb_DNA-bind_4  
Amino Acid Sequences QEFCRTPIYEQKQIWNQVAQNINLDHPNFAPTKKQCRTKWNSLKSGYENLKRLLNGNPEGFPTHTPTLHDEHFHEELSDEFWLAEPRVRAARRNQVDRRRYEYRERRRSRSRSSHHRHERRRSRSRSPRRERRERRERRRNYSLTPVIETDTVIIIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.54
3 0.48
4 0.46
5 0.48
6 0.4
7 0.36
8 0.32
9 0.31
10 0.29
11 0.28
12 0.23
13 0.19
14 0.21
15 0.18
16 0.18
17 0.25
18 0.28
19 0.39
20 0.45
21 0.54
22 0.57
23 0.67
24 0.74
25 0.77
26 0.81
27 0.8
28 0.8
29 0.74
30 0.74
31 0.67
32 0.67
33 0.62
34 0.57
35 0.51
36 0.45
37 0.44
38 0.38
39 0.36
40 0.33
41 0.31
42 0.29
43 0.27
44 0.26
45 0.24
46 0.25
47 0.24
48 0.2
49 0.2
50 0.18
51 0.17
52 0.18
53 0.19
54 0.21
55 0.21
56 0.21
57 0.17
58 0.2
59 0.21
60 0.19
61 0.17
62 0.13
63 0.12
64 0.12
65 0.11
66 0.06
67 0.05
68 0.05
69 0.06
70 0.06
71 0.08
72 0.07
73 0.08
74 0.14
75 0.15
76 0.19
77 0.24
78 0.33
79 0.38
80 0.47
81 0.55
82 0.59
83 0.65
84 0.67
85 0.69
86 0.66
87 0.64
88 0.66
89 0.68
90 0.69
91 0.73
92 0.75
93 0.77
94 0.8
95 0.84
96 0.83
97 0.83
98 0.81
99 0.82
100 0.84
101 0.86
102 0.87
103 0.89
104 0.89
105 0.9
106 0.91
107 0.9
108 0.92
109 0.89
110 0.89
111 0.9
112 0.91
113 0.91
114 0.91
115 0.92
116 0.92
117 0.95
118 0.95
119 0.94
120 0.94
121 0.94
122 0.95
123 0.95
124 0.95
125 0.93
126 0.93
127 0.88
128 0.83
129 0.83
130 0.79
131 0.72
132 0.65
133 0.56
134 0.48
135 0.42
136 0.35
137 0.25