Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HEH6

Protein Details
Accession A0A2I1HEH6   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
209-231KQLKNACETNKRKRKRGDDDFDYHydrophilic
NLS Segment(s)
PositionSequence
221-223KRK
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013761  SAM/pointed_sf  
Amino Acid Sequences YTSTSVAGNETVTLADEIKKYKTEALIDFLRKEEDLGLDDDDFEIMCKRKIMGRDFLKMSKEEFEHCGLEMGPAKRLADFAKESEYGLDFDGIDSIPLFSPLTYEIQDSNKVFKRCMEEILGRLRSYGTLQPDSLEAMRNEYVVALLHASIYIVIDITDKELSMRPQYGIVGEESRGQVDFAIKEAEDLICITEDKQHKVPVGIAQNIKQLKNACETNKRKRKRGDDDFDYLYGIVTTGRDWHFLLYSPGKISKASDTAYSIEFIKKTLNPNSEEYQSLCKNVRKVLGIIMGLLKDRACAEEEPERKRVRIEGYRSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.15
4 0.18
5 0.2
6 0.22
7 0.22
8 0.26
9 0.29
10 0.31
11 0.31
12 0.34
13 0.39
14 0.41
15 0.41
16 0.38
17 0.35
18 0.3
19 0.28
20 0.24
21 0.17
22 0.16
23 0.16
24 0.17
25 0.15
26 0.15
27 0.14
28 0.13
29 0.11
30 0.09
31 0.11
32 0.11
33 0.12
34 0.13
35 0.14
36 0.18
37 0.26
38 0.31
39 0.37
40 0.41
41 0.47
42 0.51
43 0.54
44 0.53
45 0.47
46 0.44
47 0.39
48 0.34
49 0.3
50 0.28
51 0.27
52 0.25
53 0.24
54 0.23
55 0.18
56 0.19
57 0.22
58 0.2
59 0.19
60 0.19
61 0.19
62 0.18
63 0.2
64 0.18
65 0.18
66 0.19
67 0.18
68 0.21
69 0.21
70 0.21
71 0.21
72 0.21
73 0.16
74 0.15
75 0.14
76 0.09
77 0.09
78 0.09
79 0.08
80 0.07
81 0.06
82 0.06
83 0.05
84 0.06
85 0.06
86 0.05
87 0.06
88 0.08
89 0.09
90 0.09
91 0.1
92 0.12
93 0.14
94 0.19
95 0.19
96 0.24
97 0.28
98 0.29
99 0.28
100 0.29
101 0.34
102 0.31
103 0.33
104 0.3
105 0.27
106 0.29
107 0.37
108 0.35
109 0.28
110 0.27
111 0.24
112 0.2
113 0.2
114 0.2
115 0.17
116 0.17
117 0.17
118 0.17
119 0.17
120 0.18
121 0.16
122 0.15
123 0.11
124 0.12
125 0.12
126 0.12
127 0.11
128 0.1
129 0.1
130 0.07
131 0.07
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.05
145 0.05
146 0.05
147 0.06
148 0.07
149 0.08
150 0.1
151 0.11
152 0.1
153 0.1
154 0.11
155 0.11
156 0.1
157 0.1
158 0.09
159 0.08
160 0.1
161 0.1
162 0.1
163 0.09
164 0.08
165 0.08
166 0.08
167 0.08
168 0.07
169 0.08
170 0.07
171 0.07
172 0.08
173 0.07
174 0.06
175 0.06
176 0.05
177 0.05
178 0.05
179 0.06
180 0.11
181 0.14
182 0.17
183 0.19
184 0.21
185 0.22
186 0.22
187 0.24
188 0.24
189 0.26
190 0.28
191 0.27
192 0.26
193 0.31
194 0.34
195 0.32
196 0.3
197 0.28
198 0.25
199 0.29
200 0.32
201 0.32
202 0.39
203 0.48
204 0.56
205 0.63
206 0.69
207 0.72
208 0.76
209 0.81
210 0.82
211 0.84
212 0.82
213 0.79
214 0.78
215 0.72
216 0.63
217 0.53
218 0.42
219 0.31
220 0.21
221 0.14
222 0.08
223 0.05
224 0.05
225 0.09
226 0.1
227 0.12
228 0.12
229 0.14
230 0.14
231 0.15
232 0.2
233 0.19
234 0.2
235 0.2
236 0.23
237 0.22
238 0.22
239 0.23
240 0.22
241 0.23
242 0.22
243 0.22
244 0.22
245 0.23
246 0.23
247 0.22
248 0.19
249 0.19
250 0.17
251 0.16
252 0.18
253 0.2
254 0.26
255 0.33
256 0.37
257 0.37
258 0.42
259 0.46
260 0.44
261 0.42
262 0.38
263 0.38
264 0.34
265 0.35
266 0.36
267 0.36
268 0.38
269 0.4
270 0.43
271 0.38
272 0.38
273 0.39
274 0.38
275 0.34
276 0.31
277 0.28
278 0.24
279 0.22
280 0.21
281 0.16
282 0.12
283 0.12
284 0.12
285 0.13
286 0.14
287 0.18
288 0.27
289 0.34
290 0.38
291 0.46
292 0.48
293 0.46
294 0.47
295 0.48
296 0.48
297 0.51
298 0.55