Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HPK7

Protein Details
Accession A0A2I1HPK7   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
53-97QLQNPIKKPRKGRPKKTTRIKSAMEPPKSNKSQRHCKICRQAGHYHydrophilic
NLS Segment(s)
PositionSequence
59-80KKPRKGRPKKTTRIKSAMEPPK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MEIAKKVTLKTVEKKDERIFEIFQRYLDELNDFEDELNSEIDTDDEANENSLQLQNPIKKPRKGRPKKTTRIKSAMEPPKSNKSQRHCKICRQAGHYSSTCTQNQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.66
3 0.65
4 0.62
5 0.57
6 0.49
7 0.45
8 0.49
9 0.42
10 0.36
11 0.33
12 0.3
13 0.27
14 0.25
15 0.2
16 0.13
17 0.15
18 0.14
19 0.12
20 0.11
21 0.1
22 0.1
23 0.09
24 0.09
25 0.07
26 0.06
27 0.06
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.06
35 0.06
36 0.06
37 0.06
38 0.07
39 0.07
40 0.08
41 0.12
42 0.15
43 0.2
44 0.3
45 0.37
46 0.41
47 0.48
48 0.56
49 0.64
50 0.7
51 0.77
52 0.78
53 0.82
54 0.88
55 0.92
56 0.92
57 0.9
58 0.86
59 0.78
60 0.74
61 0.73
62 0.72
63 0.67
64 0.62
65 0.59
66 0.61
67 0.64
68 0.64
69 0.62
70 0.62
71 0.67
72 0.71
73 0.77
74 0.73
75 0.78
76 0.82
77 0.82
78 0.81
79 0.76
80 0.76
81 0.68
82 0.7
83 0.61
84 0.56
85 0.51
86 0.5