Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GNZ2

Protein Details
Accession A0A2I1GNZ2   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
60-106HLRQTDKSKQNSKNSKKKPQEAKSEKHKKQKKDKSRKTSRSKVLAEIHydrophilic
NLS Segment(s)
PositionSequence
69-100QNSKNSKKKPQEAKSEKHKKQKKDKSRKTSRS
Subcellular Location(s) nucl 26
Family & Domain DBs
Amino Acid Sequences MIIHMQQYKEENTVLPSSKGLKSFKIIQTARGDRKLIGYFEKWVDMRTALDNQFDWEQLHLRQTDKSKQNSKNSKKKPQEAKSEKHKKQKKDKSRKTSRSKVLAEILDVLRKLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.22
4 0.24
5 0.26
6 0.31
7 0.29
8 0.27
9 0.3
10 0.37
11 0.39
12 0.45
13 0.42
14 0.43
15 0.5
16 0.55
17 0.57
18 0.53
19 0.5
20 0.4
21 0.44
22 0.41
23 0.33
24 0.29
25 0.24
26 0.23
27 0.22
28 0.25
29 0.2
30 0.18
31 0.18
32 0.14
33 0.14
34 0.14
35 0.17
36 0.14
37 0.15
38 0.14
39 0.15
40 0.15
41 0.14
42 0.12
43 0.09
44 0.1
45 0.1
46 0.12
47 0.12
48 0.12
49 0.15
50 0.19
51 0.27
52 0.32
53 0.4
54 0.46
55 0.53
56 0.63
57 0.7
58 0.76
59 0.79
60 0.81
61 0.85
62 0.84
63 0.86
64 0.87
65 0.84
66 0.86
67 0.83
68 0.82
69 0.83
70 0.85
71 0.83
72 0.83
73 0.83
74 0.82
75 0.84
76 0.87
77 0.87
78 0.88
79 0.91
80 0.91
81 0.95
82 0.95
83 0.95
84 0.94
85 0.92
86 0.9
87 0.83
88 0.77
89 0.73
90 0.64
91 0.55
92 0.49
93 0.42
94 0.36