Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HQI4

Protein Details
Accession A0A2I1HQI4    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
68-88VRLRGLQPKRHAKARKHISISHydrophilic
NLS Segment(s)
PositionSequence
75-83PKRHAKARK
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
Amino Acid Sequences MAMRAMVQELGNQIAQENLNRPLTYEQLMNRHRDQLTKLNISLCRECFIPIGKEEGEHCNEVRKHYLVRLRGLQPKRHAKARKHISISDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.15
5 0.17
6 0.2
7 0.2
8 0.22
9 0.21
10 0.23
11 0.22
12 0.22
13 0.21
14 0.27
15 0.31
16 0.34
17 0.33
18 0.37
19 0.36
20 0.35
21 0.36
22 0.35
23 0.38
24 0.36
25 0.35
26 0.34
27 0.35
28 0.36
29 0.35
30 0.27
31 0.22
32 0.19
33 0.19
34 0.16
35 0.16
36 0.14
37 0.12
38 0.15
39 0.14
40 0.14
41 0.15
42 0.18
43 0.18
44 0.18
45 0.18
46 0.22
47 0.24
48 0.26
49 0.28
50 0.26
51 0.25
52 0.3
53 0.36
54 0.33
55 0.37
56 0.42
57 0.44
58 0.51
59 0.56
60 0.58
61 0.61
62 0.68
63 0.68
64 0.71
65 0.74
66 0.73
67 0.78
68 0.8
69 0.81
70 0.76