Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HDI2

Protein Details
Accession A0A2I1HDI2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
28-55QDFSNQKRVRHCQKCKKTGHYAPRCPNKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences GELPQKKKTKTIRDITNVNDQHSGPVIQDFSNQKRVRHCQKCKKTGHYAPRCPNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.71
3 0.71
4 0.61
5 0.53
6 0.46
7 0.36
8 0.3
9 0.27
10 0.23
11 0.13
12 0.12
13 0.11
14 0.09
15 0.13
16 0.16
17 0.18
18 0.27
19 0.29
20 0.31
21 0.38
22 0.47
23 0.54
24 0.61
25 0.69
26 0.7
27 0.79
28 0.87
29 0.88
30 0.87
31 0.87
32 0.86
33 0.87
34 0.86
35 0.86