Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GLM4

Protein Details
Accession A0A2I1GLM4   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-85TFHWQIRKLRCNRKSSSKKSEKLITFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 11.5, mito 5, cyto 4
Family & Domain DBs
Amino Acid Sequences MKKALDSLQTKIQELQNAHQRTTNALQELQNAHQRTINALWDAENRVEELKNHKVELISTFHWQIRKLRCNRKSSSKKSEKLITFALQLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.4
4 0.41
5 0.4
6 0.39
7 0.36
8 0.36
9 0.37
10 0.34
11 0.27
12 0.27
13 0.27
14 0.28
15 0.3
16 0.28
17 0.3
18 0.27
19 0.26
20 0.25
21 0.24
22 0.23
23 0.22
24 0.21
25 0.15
26 0.14
27 0.14
28 0.14
29 0.15
30 0.13
31 0.11
32 0.09
33 0.1
34 0.1
35 0.1
36 0.15
37 0.2
38 0.21
39 0.21
40 0.22
41 0.21
42 0.21
43 0.23
44 0.22
45 0.17
46 0.18
47 0.2
48 0.21
49 0.23
50 0.24
51 0.29
52 0.34
53 0.42
54 0.5
55 0.58
56 0.64
57 0.71
58 0.76
59 0.8
60 0.81
61 0.81
62 0.83
63 0.82
64 0.8
65 0.8
66 0.83
67 0.75
68 0.69
69 0.64
70 0.56