Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1FVP8

Protein Details
Accession A0A2I1FVP8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
29-60NIINNPSKNNNSKRKEKKQKSTNTLNKKQKVSHydrophilic
NLS Segment(s)
PositionSequence
41-48KRKEKKQK
Subcellular Location(s) nucl 16, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MAKDPNNLVLIHFVMIIHNQTKSINTLKNIINNPSKNNNSKRKEKKQKSTNTLNKKQKVSITDSSGLSIQEKENITSYQQGNNENTFNAPSPILENLTLFFIQDELPCLFCDQPLPNPLPKKLLEYLKTLRRKKKILETDRGDFCFMHHAELKIVPLGGWFRELALSIYNELGQQPGYYGPKGEIAIAAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.15
4 0.14
5 0.13
6 0.14
7 0.14
8 0.16
9 0.19
10 0.24
11 0.25
12 0.25
13 0.31
14 0.34
15 0.41
16 0.43
17 0.45
18 0.48
19 0.46
20 0.5
21 0.52
22 0.56
23 0.57
24 0.64
25 0.68
26 0.66
27 0.74
28 0.79
29 0.82
30 0.87
31 0.88
32 0.89
33 0.89
34 0.93
35 0.9
36 0.91
37 0.9
38 0.89
39 0.89
40 0.88
41 0.85
42 0.77
43 0.72
44 0.65
45 0.6
46 0.56
47 0.51
48 0.46
49 0.43
50 0.4
51 0.37
52 0.33
53 0.29
54 0.22
55 0.18
56 0.12
57 0.13
58 0.14
59 0.13
60 0.14
61 0.15
62 0.15
63 0.19
64 0.2
65 0.19
66 0.21
67 0.23
68 0.24
69 0.25
70 0.24
71 0.19
72 0.19
73 0.15
74 0.13
75 0.11
76 0.09
77 0.07
78 0.08
79 0.08
80 0.09
81 0.08
82 0.08
83 0.07
84 0.08
85 0.08
86 0.07
87 0.06
88 0.06
89 0.06
90 0.06
91 0.08
92 0.07
93 0.08
94 0.08
95 0.09
96 0.09
97 0.08
98 0.11
99 0.1
100 0.13
101 0.16
102 0.18
103 0.22
104 0.25
105 0.26
106 0.28
107 0.27
108 0.28
109 0.3
110 0.35
111 0.33
112 0.36
113 0.42
114 0.46
115 0.55
116 0.59
117 0.62
118 0.63
119 0.66
120 0.66
121 0.7
122 0.72
123 0.72
124 0.74
125 0.72
126 0.71
127 0.71
128 0.66
129 0.57
130 0.45
131 0.37
132 0.34
133 0.28
134 0.25
135 0.22
136 0.22
137 0.22
138 0.23
139 0.24
140 0.17
141 0.16
142 0.12
143 0.11
144 0.12
145 0.11
146 0.12
147 0.1
148 0.1
149 0.1
150 0.11
151 0.1
152 0.11
153 0.12
154 0.12
155 0.12
156 0.12
157 0.12
158 0.12
159 0.12
160 0.1
161 0.08
162 0.08
163 0.13
164 0.16
165 0.16
166 0.17
167 0.17
168 0.21
169 0.21
170 0.21