Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GHX2

Protein Details
Accession A0A2I1GHX2   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
27-58EVEVKDSNKQKKNKQRRKKKKKSNNIENSQLSHydrophilic
NLS Segment(s)
PositionSequence
35-48KQKKNKQRRKKKKK
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MAAESNSAVEDATNVVESTQAQETNQEVEVKDSNKQKKNKQRRKKKKKSNNIENSQLSNDTVKNGKDKTSDIEDSEKVEIESPITNLRYRFLSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.08
5 0.1
6 0.12
7 0.11
8 0.11
9 0.13
10 0.14
11 0.15
12 0.16
13 0.15
14 0.13
15 0.15
16 0.18
17 0.18
18 0.22
19 0.28
20 0.36
21 0.42
22 0.49
23 0.56
24 0.64
25 0.74
26 0.8
27 0.83
28 0.85
29 0.89
30 0.94
31 0.96
32 0.96
33 0.95
34 0.95
35 0.96
36 0.95
37 0.94
38 0.89
39 0.86
40 0.77
41 0.68
42 0.58
43 0.47
44 0.37
45 0.28
46 0.22
47 0.16
48 0.16
49 0.15
50 0.18
51 0.19
52 0.21
53 0.21
54 0.23
55 0.25
56 0.3
57 0.3
58 0.28
59 0.32
60 0.3
61 0.3
62 0.3
63 0.26
64 0.19
65 0.18
66 0.16
67 0.13
68 0.14
69 0.13
70 0.17
71 0.19
72 0.21
73 0.21
74 0.23