Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PLD5

Protein Details
Accession J3PLD5    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
35-55VQAPQRSQRKNDKPHRSNLCEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027377  ZAR1/RTP1-5-like_Znf-3CxxC  
Pfam View protein in Pfam  
PF13695  zf-3CxxC  
Amino Acid Sequences MGEQNDSHHYSDPILDDSYGERVAYWLKKWSGVRVQAPQRSQRKNDKPHRSNLCEGCKAGHCKNGDWND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.14
4 0.14
5 0.16
6 0.14
7 0.12
8 0.09
9 0.09
10 0.13
11 0.14
12 0.15
13 0.18
14 0.18
15 0.23
16 0.24
17 0.28
18 0.31
19 0.34
20 0.36
21 0.38
22 0.44
23 0.44
24 0.47
25 0.5
26 0.53
27 0.53
28 0.56
29 0.6
30 0.63
31 0.69
32 0.76
33 0.79
34 0.76
35 0.8
36 0.84
37 0.79
38 0.78
39 0.75
40 0.73
41 0.66
42 0.61
43 0.55
44 0.52
45 0.52
46 0.47
47 0.45
48 0.39
49 0.37