Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G134

Protein Details
Accession A0A2I1G134   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
58-80NRAGVGKEPKKKKARVQECLKKEBasic
NLS Segment(s)
PositionSequence
56-72RKNRAGVGKEPKKKKAR
Subcellular Location(s) cyto_nucl 13.5, cyto 13, nucl 12
Family & Domain DBs
Amino Acid Sequences MTFGEEFDYLYGIITTATEWYFLLYTSESISCTSETEYHISLTKAIAKEENEAELRKNRAGVGKEPKKKKARVQECLKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.06
6 0.06
7 0.07
8 0.07
9 0.07
10 0.08
11 0.07
12 0.08
13 0.09
14 0.09
15 0.09
16 0.09
17 0.1
18 0.09
19 0.09
20 0.1
21 0.1
22 0.11
23 0.12
24 0.12
25 0.12
26 0.13
27 0.12
28 0.11
29 0.11
30 0.13
31 0.12
32 0.12
33 0.14
34 0.13
35 0.16
36 0.16
37 0.18
38 0.16
39 0.17
40 0.19
41 0.21
42 0.24
43 0.22
44 0.22
45 0.21
46 0.26
47 0.28
48 0.34
49 0.4
50 0.47
51 0.56
52 0.63
53 0.71
54 0.74
55 0.78
56 0.8
57 0.8
58 0.81
59 0.82
60 0.86