Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GVM0

Protein Details
Accession A0A2I1GVM0    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-42APYIQKIKLCNNNNKKTRRKPLKLCSDCKETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MSSKYEPRTGGAPYIQKIKLCNNNNKKTRRKPLKLCSDCKETKACVSLISSKVNRIEEIINNYHKNPKKKIEQISKFNTKFTLNNVPCELEYDLSNFTLENLQKLAIFTTQNYSNNNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.37
4 0.38
5 0.42
6 0.46
7 0.49
8 0.57
9 0.6
10 0.69
11 0.76
12 0.83
13 0.84
14 0.85
15 0.88
16 0.88
17 0.88
18 0.88
19 0.89
20 0.91
21 0.9
22 0.86
23 0.81
24 0.79
25 0.7
26 0.63
27 0.56
28 0.46
29 0.4
30 0.35
31 0.29
32 0.21
33 0.22
34 0.24
35 0.22
36 0.26
37 0.24
38 0.24
39 0.27
40 0.26
41 0.24
42 0.2
43 0.2
44 0.17
45 0.21
46 0.22
47 0.23
48 0.23
49 0.24
50 0.3
51 0.33
52 0.37
53 0.38
54 0.42
55 0.47
56 0.54
57 0.63
58 0.66
59 0.7
60 0.72
61 0.75
62 0.78
63 0.7
64 0.63
65 0.55
66 0.47
67 0.39
68 0.37
69 0.39
70 0.3
71 0.34
72 0.34
73 0.34
74 0.31
75 0.33
76 0.28
77 0.18
78 0.17
79 0.15
80 0.15
81 0.14
82 0.14
83 0.1
84 0.1
85 0.15
86 0.15
87 0.15
88 0.14
89 0.14
90 0.15
91 0.16
92 0.17
93 0.14
94 0.15
95 0.14
96 0.19
97 0.24
98 0.27