Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3P9U0

Protein Details
Accession J3P9U0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
278-299ASPYMPGRDRIDKKPKKPKPPTBasic
NLS Segment(s)
PositionSequence
287-299RIDKKPKKPKPPT
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 5.5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037830  ZZZ3  
Amino Acid Sequences MPPLSITTGSTPTGGLATGPRQPPLSASAPGAGTAADQGPAGGGAAHARPPSPPPPPVSPITPTLRTARLAGTSSTSTSGPPAMPVPPTKSGSSTHYTADPSPSALTFFAANRVALTHLSQPAQAAAGTALDAPPPPLPLDFDANPDVLALKSAISVLQIQRARAAADVARLAGAKAAALEDPDAFLRDLAEGRVSTAPAAPTLFDAGRDDGDSDSESGSDSSESDGAEHDGHRAAGDLCKGKEPATVIGPGGVYEFKGDQRQQPGGAQQAQRLVGVASPYMPGRDRIDKKPKKPKPPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.11
4 0.13
5 0.2
6 0.21
7 0.23
8 0.24
9 0.24
10 0.25
11 0.28
12 0.28
13 0.24
14 0.24
15 0.25
16 0.23
17 0.23
18 0.22
19 0.15
20 0.11
21 0.11
22 0.1
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.06
29 0.04
30 0.04
31 0.06
32 0.07
33 0.1
34 0.1
35 0.11
36 0.12
37 0.17
38 0.23
39 0.26
40 0.29
41 0.32
42 0.38
43 0.42
44 0.44
45 0.43
46 0.4
47 0.41
48 0.43
49 0.4
50 0.37
51 0.36
52 0.36
53 0.33
54 0.31
55 0.27
56 0.24
57 0.23
58 0.21
59 0.2
60 0.19
61 0.18
62 0.19
63 0.17
64 0.14
65 0.14
66 0.14
67 0.11
68 0.11
69 0.11
70 0.11
71 0.14
72 0.16
73 0.2
74 0.23
75 0.26
76 0.26
77 0.26
78 0.27
79 0.3
80 0.31
81 0.28
82 0.24
83 0.24
84 0.25
85 0.23
86 0.24
87 0.19
88 0.16
89 0.15
90 0.14
91 0.13
92 0.11
93 0.11
94 0.09
95 0.09
96 0.11
97 0.11
98 0.11
99 0.1
100 0.1
101 0.11
102 0.1
103 0.11
104 0.11
105 0.12
106 0.13
107 0.13
108 0.13
109 0.12
110 0.12
111 0.1
112 0.07
113 0.05
114 0.04
115 0.05
116 0.04
117 0.04
118 0.04
119 0.04
120 0.05
121 0.05
122 0.06
123 0.06
124 0.06
125 0.07
126 0.09
127 0.13
128 0.12
129 0.15
130 0.15
131 0.15
132 0.14
133 0.13
134 0.12
135 0.08
136 0.07
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.06
144 0.06
145 0.13
146 0.14
147 0.14
148 0.15
149 0.16
150 0.15
151 0.13
152 0.14
153 0.08
154 0.09
155 0.09
156 0.08
157 0.08
158 0.07
159 0.07
160 0.06
161 0.06
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.05
168 0.05
169 0.05
170 0.06
171 0.07
172 0.06
173 0.06
174 0.06
175 0.06
176 0.07
177 0.07
178 0.08
179 0.07
180 0.09
181 0.1
182 0.09
183 0.09
184 0.1
185 0.1
186 0.09
187 0.1
188 0.08
189 0.07
190 0.1
191 0.09
192 0.09
193 0.1
194 0.1
195 0.11
196 0.11
197 0.11
198 0.09
199 0.1
200 0.1
201 0.09
202 0.08
203 0.08
204 0.08
205 0.07
206 0.07
207 0.07
208 0.06
209 0.07
210 0.08
211 0.08
212 0.07
213 0.08
214 0.09
215 0.1
216 0.1
217 0.1
218 0.1
219 0.1
220 0.1
221 0.1
222 0.1
223 0.11
224 0.16
225 0.19
226 0.19
227 0.23
228 0.23
229 0.23
230 0.24
231 0.24
232 0.23
233 0.21
234 0.22
235 0.18
236 0.19
237 0.18
238 0.16
239 0.15
240 0.11
241 0.09
242 0.09
243 0.11
244 0.12
245 0.19
246 0.21
247 0.26
248 0.32
249 0.35
250 0.35
251 0.37
252 0.39
253 0.39
254 0.44
255 0.4
256 0.37
257 0.39
258 0.37
259 0.34
260 0.3
261 0.23
262 0.18
263 0.17
264 0.14
265 0.1
266 0.11
267 0.12
268 0.14
269 0.15
270 0.17
271 0.22
272 0.32
273 0.38
274 0.47
275 0.57
276 0.65
277 0.74
278 0.82
279 0.86