Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1E1E6

Protein Details
Accession A0A2I1E1E6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
29-49CPQRCRFVEKRYPVNQRKRATHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, plas 9, E.R. 5, mito 1, pero 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MKFSATFFLVIFLIFLINLETTTSAVCYCPQRCRFVEKRYPVNQRKRATVPITCNCNPNC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.05
9 0.06
10 0.06
11 0.05
12 0.06
13 0.08
14 0.13
15 0.15
16 0.23
17 0.26
18 0.31
19 0.32
20 0.4
21 0.46
22 0.5
23 0.57
24 0.56
25 0.62
26 0.66
27 0.76
28 0.77
29 0.8
30 0.8
31 0.75
32 0.75
33 0.71
34 0.7
35 0.66
36 0.63
37 0.62
38 0.61
39 0.65
40 0.6