Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HSG8

Protein Details
Accession A0A2I1HSG8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
135-174IKKHLQHRRDYVKRKNNIQHKKGKEKEKEREREREKEKEKBasic
NLS Segment(s)
PositionSequence
137-187KHLQHRRDYVKRKNNIQHKKGKEKEKEREREREKEKEKERENEKEKEKEKE
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MCGDDRGKYTDIGERYFGEFNTLFWHRPGSSTPSTQGSSTPASIPFPTAVAKIIYKPTKRYIKVEEILALTDLKKNEYNNLLSEVRFVMASLHTDFNIPYKSQNINLISKIIKKFTKRNPNAPFGEGNWVVKELIKKHLQHRRDYVKRKNNIQHKKGKEKEKEREREREKEKEKERENEKEKEKEKENRNEIERENENIKCK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.29
4 0.27
5 0.26
6 0.22
7 0.2
8 0.24
9 0.25
10 0.22
11 0.21
12 0.26
13 0.21
14 0.22
15 0.26
16 0.27
17 0.29
18 0.31
19 0.33
20 0.33
21 0.34
22 0.33
23 0.3
24 0.26
25 0.24
26 0.23
27 0.21
28 0.18
29 0.19
30 0.19
31 0.19
32 0.16
33 0.14
34 0.14
35 0.12
36 0.13
37 0.12
38 0.13
39 0.14
40 0.21
41 0.27
42 0.29
43 0.33
44 0.4
45 0.48
46 0.5
47 0.53
48 0.53
49 0.54
50 0.54
51 0.52
52 0.45
53 0.36
54 0.34
55 0.29
56 0.22
57 0.14
58 0.14
59 0.13
60 0.12
61 0.14
62 0.14
63 0.17
64 0.2
65 0.21
66 0.19
67 0.24
68 0.23
69 0.2
70 0.21
71 0.17
72 0.14
73 0.12
74 0.11
75 0.07
76 0.06
77 0.08
78 0.09
79 0.09
80 0.09
81 0.09
82 0.09
83 0.11
84 0.12
85 0.1
86 0.09
87 0.12
88 0.13
89 0.14
90 0.19
91 0.2
92 0.21
93 0.21
94 0.22
95 0.2
96 0.24
97 0.24
98 0.23
99 0.24
100 0.26
101 0.34
102 0.42
103 0.52
104 0.53
105 0.62
106 0.64
107 0.67
108 0.66
109 0.6
110 0.51
111 0.41
112 0.42
113 0.33
114 0.27
115 0.2
116 0.18
117 0.16
118 0.16
119 0.18
120 0.14
121 0.2
122 0.25
123 0.28
124 0.36
125 0.45
126 0.48
127 0.52
128 0.59
129 0.64
130 0.68
131 0.74
132 0.76
133 0.77
134 0.8
135 0.83
136 0.83
137 0.83
138 0.83
139 0.82
140 0.82
141 0.81
142 0.85
143 0.84
144 0.85
145 0.85
146 0.84
147 0.86
148 0.87
149 0.88
150 0.84
151 0.87
152 0.84
153 0.83
154 0.81
155 0.81
156 0.77
157 0.77
158 0.79
159 0.78
160 0.79
161 0.78
162 0.79
163 0.79
164 0.78
165 0.77
166 0.75
167 0.75
168 0.72
169 0.71
170 0.72
171 0.71
172 0.75
173 0.76
174 0.76
175 0.75
176 0.75
177 0.74
178 0.68
179 0.67
180 0.6
181 0.55
182 0.53