Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GI69

Protein Details
Accession A0A2I1GI69    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
27-47FCGYAKKKTVCKKCNKEFEGVHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 7, cyto 5, vacu 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences ISNFILLFPFSTSGTLFWAFCLGLPRFCGYAKKKTVCKKCNKEFEGVNIPEAGSMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.12
4 0.11
5 0.11
6 0.1
7 0.1
8 0.15
9 0.13
10 0.13
11 0.14
12 0.15
13 0.15
14 0.16
15 0.22
16 0.21
17 0.29
18 0.36
19 0.41
20 0.47
21 0.55
22 0.66
23 0.68
24 0.75
25 0.77
26 0.8
27 0.84
28 0.8
29 0.77
30 0.69
31 0.67
32 0.66
33 0.56
34 0.48
35 0.37
36 0.34