Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1G3E5

Protein Details
Accession A0A2I1G3E5    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
64-83RMLYHISYCPERKRRKKSITHydrophilic
NLS Segment(s)
PositionSequence
75-80RKRRKK
Subcellular Location(s) mito 18, nucl 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023580  RNA_pol_su_RPB10  
IPR020789  RNA_pol_suN_Zn-BS  
IPR000268  RPABC5/Rpb10  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF01194  RNA_pol_N  
PROSITE View protein in PROSITE  
PS01112  RNA_POL_N_8KD  
Amino Acid Sequences MIIPIRCFTCGKVLANKWNHYQTMLESEYSESAALEALGITRYCCRRMLISHVDFIQKILTFARMLYHISYCPERKRRKKSIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.56
4 0.54
5 0.53
6 0.5
7 0.43
8 0.38
9 0.31
10 0.3
11 0.28
12 0.22
13 0.18
14 0.18
15 0.17
16 0.16
17 0.14
18 0.07
19 0.06
20 0.06
21 0.05
22 0.04
23 0.03
24 0.03
25 0.04
26 0.04
27 0.04
28 0.07
29 0.09
30 0.1
31 0.12
32 0.12
33 0.14
34 0.16
35 0.24
36 0.3
37 0.3
38 0.31
39 0.31
40 0.32
41 0.3
42 0.28
43 0.23
44 0.14
45 0.13
46 0.11
47 0.11
48 0.1
49 0.1
50 0.12
51 0.11
52 0.12
53 0.13
54 0.15
55 0.14
56 0.18
57 0.25
58 0.29
59 0.37
60 0.46
61 0.55
62 0.64
63 0.73