Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1G8U3

Protein Details
Accession A0A2I1G8U3    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-42PYVQKIRFENKIKKRKPPKICSDCKETSHydrophilic
NLS Segment(s)
PositionSequence
25-32KIKKRKPP
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, mito 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSSKNYGKNTCGTPPYVQKIRFENKIKKRKPPKICSDCKETSDSVKLFSNKVNKLEEVIDNFYKNPIKKNKNNQFSIFNAKFTLNNVPCELEYDLSKFSLDNLHKLVIFTTQHCNNNNKYSSSIENINNESDDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.54
4 0.52
5 0.5
6 0.55
7 0.58
8 0.62
9 0.63
10 0.65
11 0.67
12 0.76
13 0.78
14 0.8
15 0.84
16 0.85
17 0.87
18 0.87
19 0.87
20 0.87
21 0.91
22 0.85
23 0.82
24 0.76
25 0.68
26 0.61
27 0.51
28 0.44
29 0.41
30 0.36
31 0.29
32 0.3
33 0.28
34 0.26
35 0.29
36 0.33
37 0.29
38 0.33
39 0.33
40 0.28
41 0.28
42 0.29
43 0.26
44 0.22
45 0.23
46 0.2
47 0.18
48 0.18
49 0.19
50 0.21
51 0.2
52 0.24
53 0.29
54 0.37
55 0.44
56 0.56
57 0.63
58 0.68
59 0.71
60 0.67
61 0.62
62 0.57
63 0.59
64 0.48
65 0.39
66 0.32
67 0.28
68 0.25
69 0.23
70 0.29
71 0.21
72 0.22
73 0.23
74 0.22
75 0.22
76 0.24
77 0.23
78 0.15
79 0.14
80 0.14
81 0.14
82 0.13
83 0.13
84 0.1
85 0.1
86 0.17
87 0.17
88 0.19
89 0.2
90 0.21
91 0.22
92 0.22
93 0.22
94 0.19
95 0.2
96 0.19
97 0.24
98 0.29
99 0.35
100 0.39
101 0.44
102 0.44
103 0.51
104 0.52
105 0.46
106 0.42
107 0.41
108 0.41
109 0.4
110 0.41
111 0.37
112 0.39
113 0.39
114 0.38