Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1FX32

Protein Details
Accession A0A2I1FX32    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
65-100RAKCVKIKSAQARNKKAKPRRNQRKRARTVNFIIESHydrophilic
NLS Segment(s)
PositionSequence
65-92RAKCVKIKSAQARNKKAKPRRNQRKRAR
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MRSLESIVVSQKIKALQERLDDIENRLDTLYCYYCSSETSSDSDSTEPYYVTSDEPTSSEKKISRAKCVKIKSAQARNKKAKPRRNQRKRARTVNFIIESDKLTSNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.28
4 0.32
5 0.35
6 0.35
7 0.36
8 0.34
9 0.31
10 0.33
11 0.29
12 0.25
13 0.22
14 0.19
15 0.16
16 0.18
17 0.18
18 0.13
19 0.14
20 0.14
21 0.14
22 0.15
23 0.17
24 0.15
25 0.15
26 0.16
27 0.17
28 0.17
29 0.17
30 0.16
31 0.14
32 0.14
33 0.13
34 0.1
35 0.08
36 0.09
37 0.09
38 0.09
39 0.1
40 0.08
41 0.08
42 0.09
43 0.12
44 0.12
45 0.12
46 0.15
47 0.16
48 0.22
49 0.3
50 0.31
51 0.39
52 0.45
53 0.51
54 0.56
55 0.58
56 0.6
57 0.58
58 0.64
59 0.64
60 0.67
61 0.68
62 0.71
63 0.77
64 0.79
65 0.82
66 0.83
67 0.83
68 0.83
69 0.85
70 0.86
71 0.88
72 0.89
73 0.92
74 0.93
75 0.94
76 0.94
77 0.94
78 0.9
79 0.87
80 0.83
81 0.81
82 0.74
83 0.64
84 0.56
85 0.46
86 0.41
87 0.36