Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GJM3

Protein Details
Accession A0A2I1GJM3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-31KIDLGNDNKRTRNKKKSHCPSCIETNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSYIRKIDLGNDNKRTRNKKKSHCPSCIETNDNINLFSKKINQIEEIVDKLRKNSNLQSKKADQFSIFNAKFTLNNVPCELEYNLSKFSLEDLQKLVIVTTSNCNNKYPSSNTSNESDSSEYSNNESP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.76
4 0.77
5 0.79
6 0.8
7 0.86
8 0.9
9 0.91
10 0.9
11 0.85
12 0.8
13 0.8
14 0.75
15 0.67
16 0.58
17 0.52
18 0.47
19 0.42
20 0.36
21 0.28
22 0.23
23 0.2
24 0.19
25 0.19
26 0.21
27 0.23
28 0.24
29 0.24
30 0.25
31 0.27
32 0.28
33 0.25
34 0.22
35 0.22
36 0.2
37 0.21
38 0.23
39 0.22
40 0.24
41 0.29
42 0.37
43 0.42
44 0.45
45 0.49
46 0.5
47 0.52
48 0.51
49 0.45
50 0.35
51 0.29
52 0.29
53 0.33
54 0.28
55 0.24
56 0.22
57 0.21
58 0.21
59 0.21
60 0.27
61 0.18
62 0.2
63 0.21
64 0.21
65 0.21
66 0.23
67 0.22
68 0.15
69 0.15
70 0.15
71 0.16
72 0.14
73 0.15
74 0.11
75 0.13
76 0.17
77 0.17
78 0.17
79 0.17
80 0.18
81 0.19
82 0.19
83 0.17
84 0.1
85 0.1
86 0.1
87 0.14
88 0.2
89 0.24
90 0.26
91 0.28
92 0.29
93 0.31
94 0.36
95 0.36
96 0.36
97 0.38
98 0.4
99 0.41
100 0.43
101 0.42
102 0.38
103 0.36
104 0.31
105 0.26
106 0.27
107 0.27
108 0.24