Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GGW0

Protein Details
Accession A0A2I1GGW0    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPSQKRQKQLRRQRIIRRHFQPSIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.333, nucl 13, mito 12.5, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MPSQKRQKQLRRQRIIRRHFQPSIPINNTSTLRLIANLPQQITQLKKNEYTWQKCMKLFYRNEEIRDQGKNQINPIVRTDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.91
3 0.9
4 0.85
5 0.83
6 0.76
7 0.68
8 0.66
9 0.62
10 0.62
11 0.55
12 0.5
13 0.42
14 0.42
15 0.41
16 0.33
17 0.28
18 0.19
19 0.16
20 0.14
21 0.14
22 0.13
23 0.16
24 0.17
25 0.16
26 0.16
27 0.16
28 0.17
29 0.19
30 0.2
31 0.21
32 0.22
33 0.24
34 0.25
35 0.33
36 0.41
37 0.44
38 0.47
39 0.5
40 0.52
41 0.52
42 0.56
43 0.52
44 0.52
45 0.5
46 0.5
47 0.51
48 0.51
49 0.52
50 0.5
51 0.49
52 0.44
53 0.45
54 0.4
55 0.39
56 0.43
57 0.42
58 0.41
59 0.45
60 0.45
61 0.43