Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1G3E1

Protein Details
Accession A0A2I1G3E1   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
138-166EPSTESPKAPKKKEPKNIKAKKSTYKGTTHydrophilic
NLS Segment(s)
PositionSequence
144-160PKAPKKKEPKNIKAKKS
Subcellular Location(s) nucl 21, cyto_nucl 13.833, cyto 4.5, cyto_mito 3.666
Family & Domain DBs
Amino Acid Sequences MLDESFEKAFISESVLGESTSDTPRKKRKIVEFDNLLSFEDPLFSEPEIPIMDDKNTRDSVESYGYPLRLNEMPIQKHRSVELASKINADVNLKMPVQIIDTILPEVKPSKPLQIKSPVSHKGKEKMIPEIIDFQEPEPSTESPKAPKKKEPKNIKAKKSTYKGTTTKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.15
5 0.16
6 0.15
7 0.17
8 0.22
9 0.23
10 0.31
11 0.41
12 0.49
13 0.54
14 0.6
15 0.66
16 0.72
17 0.77
18 0.78
19 0.75
20 0.7
21 0.67
22 0.59
23 0.49
24 0.38
25 0.3
26 0.2
27 0.14
28 0.11
29 0.09
30 0.1
31 0.08
32 0.09
33 0.09
34 0.11
35 0.1
36 0.11
37 0.1
38 0.1
39 0.12
40 0.14
41 0.15
42 0.18
43 0.18
44 0.18
45 0.19
46 0.19
47 0.19
48 0.2
49 0.19
50 0.17
51 0.18
52 0.18
53 0.17
54 0.16
55 0.16
56 0.13
57 0.15
58 0.17
59 0.21
60 0.24
61 0.28
62 0.34
63 0.32
64 0.32
65 0.31
66 0.27
67 0.23
68 0.24
69 0.24
70 0.21
71 0.21
72 0.21
73 0.2
74 0.19
75 0.18
76 0.16
77 0.11
78 0.1
79 0.12
80 0.12
81 0.12
82 0.12
83 0.11
84 0.11
85 0.11
86 0.1
87 0.08
88 0.09
89 0.09
90 0.09
91 0.08
92 0.08
93 0.09
94 0.09
95 0.12
96 0.13
97 0.21
98 0.26
99 0.29
100 0.34
101 0.42
102 0.46
103 0.47
104 0.54
105 0.54
106 0.52
107 0.55
108 0.55
109 0.51
110 0.52
111 0.54
112 0.48
113 0.47
114 0.47
115 0.43
116 0.39
117 0.38
118 0.34
119 0.31
120 0.29
121 0.22
122 0.24
123 0.23
124 0.23
125 0.2
126 0.2
127 0.23
128 0.26
129 0.28
130 0.31
131 0.4
132 0.48
133 0.5
134 0.59
135 0.65
136 0.72
137 0.8
138 0.83
139 0.84
140 0.86
141 0.91
142 0.91
143 0.91
144 0.89
145 0.89
146 0.86
147 0.85
148 0.8
149 0.79