Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1FX67

Protein Details
Accession A0A2I1FX67    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-44AEYAKVRKSTQSTQRQKKKLRCFPRCFKKKPPSFYHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MIFFKQKYAEYAKVRKSTQSTQRQKKKLRCFPRCFKKKPPSFYHLLKPSSHTIPRNNKFLDPCSILYHRIYQTYHIFTPFNHKQQSKEENY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.6
4 0.61
5 0.62
6 0.65
7 0.67
8 0.71
9 0.8
10 0.84
11 0.87
12 0.88
13 0.89
14 0.88
15 0.88
16 0.88
17 0.88
18 0.89
19 0.9
20 0.91
21 0.86
22 0.86
23 0.86
24 0.83
25 0.82
26 0.79
27 0.73
28 0.69
29 0.67
30 0.64
31 0.61
32 0.55
33 0.46
34 0.42
35 0.4
36 0.39
37 0.39
38 0.34
39 0.36
40 0.44
41 0.48
42 0.52
43 0.5
44 0.48
45 0.46
46 0.46
47 0.42
48 0.35
49 0.33
50 0.31
51 0.32
52 0.31
53 0.3
54 0.33
55 0.28
56 0.28
57 0.27
58 0.27
59 0.31
60 0.34
61 0.34
62 0.3
63 0.29
64 0.26
65 0.36
66 0.39
67 0.41
68 0.44
69 0.44
70 0.46
71 0.55