Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PIY4

Protein Details
Accession J3PIY4    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-44RGSRRPPTTRPSSPRARRQTRACQRSRGTHydrophilic
284-304RDPFLKAKPFKKNIPSYPFKNHydrophilic
NLS Segment(s)
PositionSequence
17-33GSRRPPTTRPSSPRARR
Subcellular Location(s) mito 14, mito_nucl 12.5, nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MTIKTRTTADSRPTARGSRRPPTTRPSSPRARRQTRACQRSRGTAASSSPSPPKGKATGSADAAGFAEPIPSDPCITAGDLSTYLKTYRWKKEVTVYPNPVSFPSAKDKANWQGALPDIGERHTFQQWWAARRKGEGEPLLALFSVYPKSRRLTKSKMTYMVIIWDCDPRLYWDPKTGAQRQLQNGDRCSYILQRNLYSIVRGFAKTAELFYSVDTSRSGQDRCLFYALKRLDEWYQLKNQEFQGESDPRSLVARKKESPRSVVLRSHLMNLCQCRANMGWALRDPFLKAKPFKKNIPSYPFKNLVKFMLKLVELA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.59
3 0.62
4 0.63
5 0.64
6 0.7
7 0.71
8 0.72
9 0.73
10 0.75
11 0.76
12 0.75
13 0.74
14 0.75
15 0.78
16 0.82
17 0.84
18 0.84
19 0.82
20 0.84
21 0.87
22 0.87
23 0.88
24 0.83
25 0.82
26 0.77
27 0.78
28 0.74
29 0.66
30 0.59
31 0.52
32 0.49
33 0.44
34 0.42
35 0.36
36 0.35
37 0.36
38 0.35
39 0.33
40 0.35
41 0.34
42 0.34
43 0.38
44 0.39
45 0.39
46 0.39
47 0.39
48 0.34
49 0.3
50 0.28
51 0.21
52 0.15
53 0.1
54 0.08
55 0.06
56 0.07
57 0.08
58 0.08
59 0.09
60 0.09
61 0.1
62 0.11
63 0.12
64 0.11
65 0.1
66 0.11
67 0.11
68 0.12
69 0.11
70 0.11
71 0.11
72 0.13
73 0.2
74 0.27
75 0.34
76 0.39
77 0.4
78 0.42
79 0.51
80 0.57
81 0.58
82 0.6
83 0.57
84 0.54
85 0.54
86 0.52
87 0.43
88 0.37
89 0.29
90 0.22
91 0.24
92 0.25
93 0.24
94 0.25
95 0.3
96 0.34
97 0.39
98 0.36
99 0.29
100 0.27
101 0.27
102 0.27
103 0.22
104 0.16
105 0.11
106 0.11
107 0.12
108 0.11
109 0.13
110 0.13
111 0.13
112 0.12
113 0.2
114 0.22
115 0.27
116 0.32
117 0.33
118 0.32
119 0.33
120 0.37
121 0.31
122 0.34
123 0.29
124 0.24
125 0.22
126 0.21
127 0.2
128 0.16
129 0.14
130 0.08
131 0.07
132 0.08
133 0.08
134 0.09
135 0.11
136 0.14
137 0.21
138 0.26
139 0.32
140 0.38
141 0.45
142 0.53
143 0.55
144 0.57
145 0.51
146 0.47
147 0.4
148 0.39
149 0.31
150 0.22
151 0.18
152 0.15
153 0.14
154 0.13
155 0.13
156 0.11
157 0.15
158 0.18
159 0.18
160 0.22
161 0.24
162 0.28
163 0.35
164 0.35
165 0.37
166 0.38
167 0.43
168 0.41
169 0.46
170 0.48
171 0.46
172 0.43
173 0.38
174 0.34
175 0.29
176 0.27
177 0.25
178 0.23
179 0.24
180 0.24
181 0.23
182 0.24
183 0.26
184 0.25
185 0.21
186 0.17
187 0.14
188 0.14
189 0.14
190 0.13
191 0.11
192 0.13
193 0.12
194 0.13
195 0.12
196 0.11
197 0.11
198 0.11
199 0.14
200 0.12
201 0.12
202 0.12
203 0.12
204 0.13
205 0.17
206 0.17
207 0.17
208 0.23
209 0.24
210 0.26
211 0.28
212 0.26
213 0.23
214 0.32
215 0.3
216 0.26
217 0.25
218 0.26
219 0.24
220 0.31
221 0.34
222 0.29
223 0.34
224 0.36
225 0.37
226 0.38
227 0.38
228 0.35
229 0.33
230 0.3
231 0.31
232 0.31
233 0.31
234 0.29
235 0.28
236 0.24
237 0.26
238 0.27
239 0.26
240 0.31
241 0.37
242 0.42
243 0.51
244 0.6
245 0.63
246 0.64
247 0.66
248 0.64
249 0.62
250 0.6
251 0.55
252 0.52
253 0.48
254 0.5
255 0.44
256 0.4
257 0.4
258 0.39
259 0.39
260 0.35
261 0.34
262 0.3
263 0.29
264 0.29
265 0.29
266 0.28
267 0.29
268 0.3
269 0.33
270 0.31
271 0.31
272 0.3
273 0.31
274 0.34
275 0.37
276 0.41
277 0.47
278 0.56
279 0.63
280 0.69
281 0.73
282 0.78
283 0.79
284 0.81
285 0.81
286 0.76
287 0.78
288 0.78
289 0.72
290 0.67
291 0.6
292 0.58
293 0.56
294 0.51
295 0.45
296 0.42