Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HMX2

Protein Details
Accession A0A2I1HMX2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
38-61EEEEKKMKIEKRRKKMKMKKILFLBasic
NLS Segment(s)
PositionSequence
42-57KKMKIEKRRKKMKMKK
Subcellular Location(s) cyto 14, cyto_nucl 13, nucl 10
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGEQKIKIQPQMAIGYEFNFCFIFYKLYSKEEEESENEEEEKKMKIEKRRKKMKMKKILFLLVDLGFKFHHLIVEHMTLTLVQVFEFYDITIEVDKGLYENDGTLAHIKLPNISPEIFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.24
4 0.22
5 0.18
6 0.14
7 0.13
8 0.12
9 0.12
10 0.13
11 0.13
12 0.19
13 0.2
14 0.22
15 0.24
16 0.25
17 0.26
18 0.25
19 0.27
20 0.23
21 0.25
22 0.25
23 0.23
24 0.21
25 0.2
26 0.18
27 0.17
28 0.15
29 0.12
30 0.16
31 0.2
32 0.3
33 0.4
34 0.49
35 0.59
36 0.69
37 0.77
38 0.83
39 0.88
40 0.89
41 0.89
42 0.84
43 0.8
44 0.73
45 0.68
46 0.57
47 0.47
48 0.39
49 0.28
50 0.24
51 0.18
52 0.14
53 0.09
54 0.09
55 0.1
56 0.07
57 0.08
58 0.08
59 0.09
60 0.11
61 0.14
62 0.13
63 0.12
64 0.12
65 0.1
66 0.1
67 0.1
68 0.07
69 0.05
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.07
78 0.07
79 0.07
80 0.06
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.09
91 0.1
92 0.11
93 0.13
94 0.15
95 0.15
96 0.18
97 0.2
98 0.23
99 0.24