Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1GKH5

Protein Details
Accession A0A2I1GKH5    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-70FSKLSDEKKKRIRKIITVEPKKBasic
NLS Segment(s)
PositionSequence
56-70KKKRIRKIITVEPKK
Subcellular Location(s) mito 14, nucl 12.5, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MVKTALRSELCNRDKRVTQPIEEYVKRKIIPSLPSGIRSYADYEKTNYFSKLSDEKKKRIRKIITVEPKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.6
4 0.53
5 0.5
6 0.47
7 0.49
8 0.51
9 0.49
10 0.46
11 0.4
12 0.4
13 0.38
14 0.34
15 0.31
16 0.28
17 0.28
18 0.28
19 0.31
20 0.27
21 0.29
22 0.29
23 0.26
24 0.22
25 0.19
26 0.21
27 0.18
28 0.2
29 0.19
30 0.21
31 0.22
32 0.25
33 0.26
34 0.23
35 0.21
36 0.18
37 0.22
38 0.28
39 0.33
40 0.41
41 0.46
42 0.55
43 0.64
44 0.73
45 0.77
46 0.79
47 0.8
48 0.79
49 0.81
50 0.83