Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HG25

Protein Details
Accession A0A2I1HG25   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-29KETPEIKKVTEKRKLKLKNNQFLPKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000210  BTB/POZ_dom  
IPR011333  SKP1/BTB/POZ_sf  
Pfam View protein in Pfam  
PF00651  BTB  
PROSITE View protein in PROSITE  
PS50097  BTB  
CDD cd18186  BTB_POZ_ZBTB_KLHL-like  
Amino Acid Sequences MQKKETPEIKKVTEKRKLKLKNNQFLPKTQFINVSTAEDTRPTVDAVPTVDATPTAEDDEYYDITIEVGEDPNVKILRAHMNILCYRSPYLRRALASNKKNKDNVLAHIKLSKISPEIFQIILK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.73
3 0.76
4 0.8
5 0.8
6 0.82
7 0.83
8 0.83
9 0.86
10 0.88
11 0.8
12 0.76
13 0.73
14 0.68
15 0.6
16 0.51
17 0.46
18 0.38
19 0.38
20 0.33
21 0.28
22 0.23
23 0.21
24 0.2
25 0.16
26 0.15
27 0.13
28 0.13
29 0.1
30 0.1
31 0.09
32 0.1
33 0.1
34 0.11
35 0.1
36 0.09
37 0.09
38 0.08
39 0.08
40 0.08
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.08
47 0.08
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.05
54 0.04
55 0.04
56 0.04
57 0.05
58 0.05
59 0.09
60 0.09
61 0.09
62 0.09
63 0.11
64 0.18
65 0.18
66 0.21
67 0.18
68 0.22
69 0.24
70 0.27
71 0.25
72 0.2
73 0.2
74 0.22
75 0.25
76 0.24
77 0.28
78 0.3
79 0.31
80 0.34
81 0.43
82 0.48
83 0.54
84 0.61
85 0.62
86 0.65
87 0.66
88 0.63
89 0.62
90 0.56
91 0.54
92 0.54
93 0.49
94 0.44
95 0.44
96 0.43
97 0.36
98 0.33
99 0.28
100 0.22
101 0.21
102 0.21
103 0.22
104 0.24