Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1HMR9

Protein Details
Accession A0A2I1HMR9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-41PYVQKFRFENKIKKRKPLKNCFDCKEMHydrophilic
NLS Segment(s)
PositionSequence
27-30KKRK
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MSSKNYGQKTCGTPPYVQKFRFENKIKKRKPLKNCFDCKEMSDSVKLFSSKVNKIEEVINNFYKNPIKKNKNNQFSIFNAKFTLNNIPCELEYDLSKFSLENLHKLVIFTTQHCNNDNKYSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.61
3 0.62
4 0.57
5 0.55
6 0.55
7 0.57
8 0.63
9 0.62
10 0.63
11 0.65
12 0.75
13 0.76
14 0.8
15 0.84
16 0.83
17 0.86
18 0.86
19 0.86
20 0.85
21 0.89
22 0.83
23 0.76
24 0.68
25 0.59
26 0.53
27 0.44
28 0.36
29 0.3
30 0.25
31 0.23
32 0.24
33 0.22
34 0.17
35 0.18
36 0.22
37 0.22
38 0.26
39 0.27
40 0.24
41 0.25
42 0.29
43 0.28
44 0.27
45 0.28
46 0.26
47 0.24
48 0.24
49 0.25
50 0.25
51 0.24
52 0.26
53 0.32
54 0.39
55 0.47
56 0.58
57 0.66
58 0.71
59 0.73
60 0.7
61 0.64
62 0.58
63 0.6
64 0.5
65 0.41
66 0.33
67 0.29
68 0.27
69 0.24
70 0.31
71 0.23
72 0.24
73 0.24
74 0.24
75 0.23
76 0.26
77 0.25
78 0.16
79 0.16
80 0.15
81 0.15
82 0.14
83 0.14
84 0.11
85 0.11
86 0.18
87 0.18
88 0.2
89 0.22
90 0.23
91 0.24
92 0.24
93 0.24
94 0.21
95 0.22
96 0.21
97 0.26
98 0.31
99 0.34
100 0.37
101 0.4
102 0.39
103 0.46