Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GIP8

Protein Details
Accession A0A2I1GIP8   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
34-58PYSPDITKPKPPRPKSPSPPHVIKAHydrophilic
NLS Segment(s)
PositionSequence
44-47PPRP
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR027329  TPX2_C  
IPR009675  TPX2_fam  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005874  C:microtubule  
GO:0005819  C:spindle  
GO:0032147  P:activation of protein kinase activity  
GO:0060236  P:regulation of mitotic spindle organization  
Pfam View protein in Pfam  
PF06886  TPX2  
Amino Acid Sequences MRGYRFKANPLDRKILENRNFGVPKVQKQKLTEPYSPDITKPKPPRPKSPSPPHVIKANPVPDYKEPYRPVIEHRLIELPVFSLPGEEISKRKSQEIEERIRQEKEKMEKMREFKAQPLPTGSPDCLPTRPYYPPTHPKPFALLTNDRGEKYQREFYEKVRKEQEYIKESRFHAQPLPNFEPKIPRKPECPPPTEPIGFFFFTDTRMEERHIYDEHRRFREKEAEEQRIAKIREEEVRSAEEIRRLRADLVHHAQPIRYYSPINIQPSDKKPTRPISPMIGEKRLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.68
3 0.66
4 0.62
5 0.58
6 0.58
7 0.58
8 0.51
9 0.53
10 0.48
11 0.51
12 0.55
13 0.58
14 0.54
15 0.58
16 0.67
17 0.67
18 0.69
19 0.64
20 0.61
21 0.6
22 0.62
23 0.57
24 0.51
25 0.49
26 0.45
27 0.5
28 0.53
29 0.58
30 0.62
31 0.67
32 0.75
33 0.76
34 0.83
35 0.84
36 0.86
37 0.85
38 0.83
39 0.83
40 0.75
41 0.73
42 0.64
43 0.58
44 0.55
45 0.52
46 0.48
47 0.42
48 0.43
49 0.4
50 0.47
51 0.45
52 0.45
53 0.41
54 0.42
55 0.44
56 0.41
57 0.43
58 0.45
59 0.46
60 0.38
61 0.38
62 0.37
63 0.33
64 0.31
65 0.26
66 0.16
67 0.12
68 0.12
69 0.09
70 0.06
71 0.06
72 0.08
73 0.1
74 0.1
75 0.12
76 0.15
77 0.2
78 0.21
79 0.23
80 0.23
81 0.26
82 0.35
83 0.42
84 0.47
85 0.49
86 0.54
87 0.55
88 0.55
89 0.52
90 0.45
91 0.44
92 0.42
93 0.44
94 0.44
95 0.47
96 0.51
97 0.53
98 0.55
99 0.54
100 0.48
101 0.45
102 0.49
103 0.44
104 0.39
105 0.4
106 0.36
107 0.32
108 0.33
109 0.28
110 0.19
111 0.2
112 0.21
113 0.18
114 0.18
115 0.17
116 0.18
117 0.2
118 0.24
119 0.26
120 0.31
121 0.39
122 0.45
123 0.52
124 0.49
125 0.47
126 0.46
127 0.43
128 0.39
129 0.35
130 0.31
131 0.26
132 0.3
133 0.31
134 0.28
135 0.27
136 0.25
137 0.23
138 0.25
139 0.28
140 0.23
141 0.29
142 0.3
143 0.36
144 0.45
145 0.45
146 0.46
147 0.46
148 0.46
149 0.41
150 0.46
151 0.47
152 0.43
153 0.44
154 0.42
155 0.4
156 0.41
157 0.44
158 0.38
159 0.32
160 0.31
161 0.32
162 0.33
163 0.36
164 0.41
165 0.38
166 0.38
167 0.37
168 0.41
169 0.41
170 0.48
171 0.46
172 0.43
173 0.45
174 0.51
175 0.61
176 0.59
177 0.59
178 0.54
179 0.52
180 0.56
181 0.53
182 0.47
183 0.39
184 0.35
185 0.3
186 0.25
187 0.23
188 0.16
189 0.16
190 0.17
191 0.15
192 0.14
193 0.14
194 0.17
195 0.17
196 0.19
197 0.21
198 0.21
199 0.24
200 0.32
201 0.39
202 0.45
203 0.49
204 0.52
205 0.5
206 0.55
207 0.6
208 0.54
209 0.56
210 0.58
211 0.58
212 0.57
213 0.57
214 0.54
215 0.52
216 0.5
217 0.43
218 0.36
219 0.33
220 0.37
221 0.39
222 0.38
223 0.33
224 0.34
225 0.32
226 0.32
227 0.31
228 0.31
229 0.29
230 0.3
231 0.3
232 0.29
233 0.29
234 0.29
235 0.31
236 0.33
237 0.37
238 0.38
239 0.38
240 0.38
241 0.37
242 0.37
243 0.37
244 0.31
245 0.27
246 0.24
247 0.23
248 0.31
249 0.37
250 0.4
251 0.38
252 0.4
253 0.47
254 0.51
255 0.58
256 0.54
257 0.54
258 0.57
259 0.63
260 0.66
261 0.63
262 0.63
263 0.62
264 0.64
265 0.68
266 0.66