Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2I1HG17

Protein Details
Accession A0A2I1HG17    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
167-188SGSGSLKPRKKVKSIKKGLKTAHydrophilic
NLS Segment(s)
PositionSequence
172-188LKPRKKVKSIKKGLKTA
Subcellular Location(s) nucl 13mito 13mito_nucl 13
Family & Domain DBs
Amino Acid Sequences MLTIITNNKHIIKKYDKPFKIYSDRAIMNTKYRISKYLTSVFCGLPIDIETRNKYFLRIRQLLLDKLVAIENRLKKQDKNRQTTTYIRFSCGKRMWYLGFYITCSYCKNACAYVMSRNRKVCQNCRSKVITTPAPPTQNKFKDFTQTKQVISKRRGVSYTKKVAMDSGSGSLKPRKKVKSIKKGLKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.67
3 0.65
4 0.67
5 0.69
6 0.69
7 0.69
8 0.64
9 0.59
10 0.56
11 0.55
12 0.52
13 0.52
14 0.46
15 0.43
16 0.43
17 0.41
18 0.39
19 0.38
20 0.39
21 0.39
22 0.41
23 0.41
24 0.46
25 0.42
26 0.4
27 0.41
28 0.38
29 0.33
30 0.29
31 0.22
32 0.14
33 0.14
34 0.13
35 0.13
36 0.17
37 0.19
38 0.19
39 0.23
40 0.23
41 0.25
42 0.28
43 0.31
44 0.37
45 0.38
46 0.37
47 0.41
48 0.44
49 0.42
50 0.38
51 0.33
52 0.23
53 0.2
54 0.21
55 0.13
56 0.11
57 0.16
58 0.19
59 0.22
60 0.27
61 0.29
62 0.31
63 0.42
64 0.51
65 0.54
66 0.58
67 0.61
68 0.6
69 0.63
70 0.66
71 0.61
72 0.6
73 0.51
74 0.45
75 0.43
76 0.4
77 0.43
78 0.39
79 0.35
80 0.27
81 0.29
82 0.27
83 0.23
84 0.23
85 0.17
86 0.15
87 0.14
88 0.14
89 0.12
90 0.12
91 0.12
92 0.13
93 0.12
94 0.12
95 0.13
96 0.12
97 0.12
98 0.14
99 0.15
100 0.22
101 0.3
102 0.35
103 0.39
104 0.42
105 0.44
106 0.48
107 0.54
108 0.54
109 0.55
110 0.59
111 0.57
112 0.59
113 0.61
114 0.55
115 0.54
116 0.52
117 0.48
118 0.42
119 0.44
120 0.44
121 0.46
122 0.46
123 0.45
124 0.49
125 0.49
126 0.48
127 0.46
128 0.43
129 0.47
130 0.5
131 0.5
132 0.5
133 0.47
134 0.46
135 0.5
136 0.54
137 0.53
138 0.53
139 0.57
140 0.52
141 0.53
142 0.55
143 0.53
144 0.57
145 0.58
146 0.63
147 0.59
148 0.56
149 0.52
150 0.5
151 0.45
152 0.38
153 0.3
154 0.25
155 0.22
156 0.21
157 0.24
158 0.31
159 0.34
160 0.4
161 0.47
162 0.49
163 0.58
164 0.68
165 0.76
166 0.79
167 0.84
168 0.87