Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

J3PKZ0

Protein Details
Accession J3PKZ0    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
107-130INSNAAKGRKRGRKQGKSDPGGGAHydrophilic
NLS Segment(s)
PositionSequence
112-126AKGRKRGRKQGKSDP
Subcellular Location(s) mito 13, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPGVPAPQMPRMPPPQMPGMPAPQMPGMLPQPRPRMPPPQMPGVPPPPTPGVPPPPTPGVPPPPTPRVPPPPTPRVPPPPTPKMPIPRMPSPPTPEIGPGSAIGIQINSNAAKGRKRGRKQGKSDPGGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.41
4 0.42
5 0.39
6 0.37
7 0.35
8 0.33
9 0.31
10 0.23
11 0.22
12 0.19
13 0.19
14 0.19
15 0.21
16 0.25
17 0.3
18 0.37
19 0.39
20 0.45
21 0.45
22 0.5
23 0.5
24 0.56
25 0.52
26 0.54
27 0.53
28 0.5
29 0.52
30 0.48
31 0.45
32 0.36
33 0.35
34 0.29
35 0.28
36 0.27
37 0.26
38 0.28
39 0.28
40 0.29
41 0.29
42 0.3
43 0.3
44 0.3
45 0.3
46 0.3
47 0.3
48 0.32
49 0.34
50 0.36
51 0.37
52 0.37
53 0.39
54 0.4
55 0.42
56 0.46
57 0.48
58 0.52
59 0.53
60 0.55
61 0.55
62 0.55
63 0.55
64 0.55
65 0.56
66 0.56
67 0.56
68 0.57
69 0.57
70 0.56
71 0.58
72 0.57
73 0.56
74 0.54
75 0.58
76 0.58
77 0.57
78 0.55
79 0.51
80 0.45
81 0.39
82 0.35
83 0.3
84 0.26
85 0.21
86 0.15
87 0.15
88 0.14
89 0.13
90 0.11
91 0.09
92 0.08
93 0.08
94 0.1
95 0.09
96 0.08
97 0.12
98 0.15
99 0.19
100 0.27
101 0.36
102 0.45
103 0.53
104 0.64
105 0.71
106 0.79
107 0.84
108 0.88
109 0.89
110 0.84