Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3PCD7

Protein Details
Accession J3PCD7    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
3-28GGARSRSPSRERPRQPQPDRSFRDRDBasic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
Amino Acid Sequences MAGGARSRSPSRERPRQPQPDRSFRDRDDPDRRKDRDDPDRRGGGEEMIVVHVNDRLGTKAAIPCFASDRVREFKIMVAARIGREPHEILLKRQGERPFKDQLTLEDYGVSNGVQIDLEVDTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.79
3 0.85
4 0.86
5 0.87
6 0.86
7 0.85
8 0.84
9 0.82
10 0.78
11 0.69
12 0.71
13 0.65
14 0.66
15 0.66
16 0.66
17 0.68
18 0.71
19 0.71
20 0.67
21 0.68
22 0.68
23 0.68
24 0.7
25 0.69
26 0.66
27 0.67
28 0.61
29 0.57
30 0.48
31 0.37
32 0.28
33 0.2
34 0.13
35 0.1
36 0.1
37 0.07
38 0.07
39 0.07
40 0.06
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.08
47 0.1
48 0.11
49 0.11
50 0.11
51 0.11
52 0.13
53 0.15
54 0.15
55 0.13
56 0.17
57 0.2
58 0.21
59 0.21
60 0.19
61 0.18
62 0.23
63 0.23
64 0.19
65 0.18
66 0.18
67 0.18
68 0.2
69 0.19
70 0.14
71 0.16
72 0.17
73 0.16
74 0.23
75 0.23
76 0.23
77 0.32
78 0.34
79 0.33
80 0.39
81 0.45
82 0.45
83 0.49
84 0.51
85 0.5
86 0.47
87 0.49
88 0.44
89 0.4
90 0.38
91 0.35
92 0.3
93 0.24
94 0.23
95 0.2
96 0.2
97 0.16
98 0.1
99 0.09
100 0.09
101 0.06
102 0.06
103 0.07
104 0.06