Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2I1GCU0

Protein Details
Accession A0A2I1GCU0    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-37TETPMIRKNTNIRKQRRRSSLDKRGKRASSHydrophilic
NLS Segment(s)
PositionSequence
19-35IRKQRRRSSLDKRGKRA
Subcellular Location(s) nucl 14.5, cyto_nucl 9, mito 8, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013218  Dsn1/Mis13  
Gene Ontology GO:0000444  C:MIS12/MIND type complex  
GO:0051301  P:cell division  
GO:0007059  P:chromosome segregation  
Pfam View protein in Pfam  
PF08202  MIS13  
Amino Acid Sequences TEVPIPLTETPMIRKNTNIRKQRRRSSLDKRGKRASSIGNGFIAKPHPDISHKEFYRHIQPDLPGPIRLRQLLAWCGQRTLENQKSEYENALKIAKILEADILNDIMDSKINTSWYHRNVRYVPIYITCR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.42
3 0.51
4 0.58
5 0.63
6 0.67
7 0.74
8 0.84
9 0.88
10 0.88
11 0.84
12 0.85
13 0.86
14 0.87
15 0.87
16 0.85
17 0.83
18 0.82
19 0.76
20 0.69
21 0.63
22 0.58
23 0.55
24 0.49
25 0.44
26 0.37
27 0.36
28 0.33
29 0.29
30 0.25
31 0.18
32 0.15
33 0.15
34 0.14
35 0.17
36 0.22
37 0.28
38 0.35
39 0.34
40 0.36
41 0.36
42 0.37
43 0.44
44 0.4
45 0.35
46 0.28
47 0.28
48 0.29
49 0.32
50 0.3
51 0.23
52 0.22
53 0.24
54 0.23
55 0.22
56 0.19
57 0.16
58 0.17
59 0.17
60 0.2
61 0.21
62 0.2
63 0.2
64 0.2
65 0.2
66 0.2
67 0.28
68 0.3
69 0.28
70 0.29
71 0.31
72 0.33
73 0.33
74 0.33
75 0.26
76 0.2
77 0.2
78 0.2
79 0.18
80 0.15
81 0.15
82 0.12
83 0.1
84 0.1
85 0.1
86 0.09
87 0.1
88 0.1
89 0.1
90 0.09
91 0.08
92 0.09
93 0.06
94 0.07
95 0.07
96 0.08
97 0.09
98 0.11
99 0.13
100 0.18
101 0.27
102 0.33
103 0.43
104 0.43
105 0.49
106 0.5
107 0.57
108 0.56
109 0.51
110 0.47