Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

J3NYF9

Protein Details
Accession J3NYF9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-58AGDRPGGDPHRQRRRRTCASLWWWRLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 4, vacu 4, pero 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002656  Acyl_transf_3_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
Pfam View protein in Pfam  
PF01757  Acyl_transf_3  
Amino Acid Sequences MFLFYCGAVLAELDLVRDAETDPATTAIPAQPAGDRPGGDPHRQRRRRTCASLWWWRLVSFAALYLMSQPDFGADETPGWVFLSGLVPDCWADDGYRHWQSVGAVLFVAAVARLPGWQALFNLAPARYLGRVSYALYLVHGPVLHTAGYLIEMRTFAITTAGGQMITDRGYVAGFALGVAFIVPIVVWAADVFWRAVDAPVVRLARRLEARARPRDDGLRDCVFQLGFPLINMCLFVGILFCG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.08
6 0.1
7 0.1
8 0.11
9 0.11
10 0.12
11 0.12
12 0.11
13 0.12
14 0.11
15 0.12
16 0.11
17 0.12
18 0.13
19 0.15
20 0.18
21 0.19
22 0.18
23 0.18
24 0.27
25 0.31
26 0.36
27 0.43
28 0.5
29 0.59
30 0.66
31 0.74
32 0.74
33 0.8
34 0.83
35 0.83
36 0.79
37 0.78
38 0.79
39 0.81
40 0.74
41 0.69
42 0.6
43 0.51
44 0.46
45 0.36
46 0.28
47 0.17
48 0.14
49 0.1
50 0.09
51 0.09
52 0.09
53 0.1
54 0.08
55 0.08
56 0.07
57 0.07
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.07
67 0.07
68 0.05
69 0.06
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.07
80 0.06
81 0.09
82 0.16
83 0.18
84 0.18
85 0.17
86 0.17
87 0.17
88 0.21
89 0.18
90 0.11
91 0.09
92 0.09
93 0.09
94 0.08
95 0.07
96 0.03
97 0.02
98 0.02
99 0.02
100 0.02
101 0.03
102 0.04
103 0.04
104 0.05
105 0.05
106 0.07
107 0.07
108 0.08
109 0.09
110 0.08
111 0.08
112 0.08
113 0.09
114 0.07
115 0.07
116 0.07
117 0.07
118 0.08
119 0.09
120 0.1
121 0.1
122 0.09
123 0.09
124 0.1
125 0.08
126 0.08
127 0.07
128 0.06
129 0.06
130 0.07
131 0.06
132 0.06
133 0.06
134 0.05
135 0.06
136 0.07
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.07
143 0.05
144 0.06
145 0.05
146 0.05
147 0.07
148 0.07
149 0.06
150 0.06
151 0.07
152 0.07
153 0.07
154 0.07
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.04
161 0.04
162 0.04
163 0.04
164 0.03
165 0.03
166 0.03
167 0.03
168 0.02
169 0.02
170 0.02
171 0.02
172 0.03
173 0.03
174 0.03
175 0.03
176 0.04
177 0.05
178 0.06
179 0.06
180 0.05
181 0.06
182 0.06
183 0.07
184 0.09
185 0.09
186 0.1
187 0.16
188 0.18
189 0.18
190 0.21
191 0.22
192 0.26
193 0.29
194 0.32
195 0.34
196 0.42
197 0.51
198 0.57
199 0.61
200 0.58
201 0.59
202 0.63
203 0.6
204 0.56
205 0.54
206 0.49
207 0.44
208 0.41
209 0.39
210 0.31
211 0.26
212 0.23
213 0.19
214 0.14
215 0.13
216 0.14
217 0.12
218 0.12
219 0.13
220 0.1
221 0.08
222 0.07
223 0.07